Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 940510..941174 | Replicon | chromosome |
Accession | NZ_CP104011 | ||
Organism | Pseudomonas sp. GCEP-101 isolate Gut |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | N0B71_RS04355 | Protein ID | WP_259757474.1 |
Coordinates | 940767..941174 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | N0B71_RS04350 | Protein ID | WP_259757473.1 |
Coordinates | 940510..940770 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B71_RS04335 | 937097..937873 | - | 777 | WP_259757469.1 | ferredoxin--NADP reductase | - |
N0B71_RS04340 | 937980..938972 | - | 993 | WP_259757471.1 | TRAP transporter substrate-binding protein | - |
N0B71_RS04345 | 939309..940433 | + | 1125 | WP_259757472.1 | class I SAM-dependent methyltransferase | - |
N0B71_RS04350 | 940510..940770 | + | 261 | WP_259757473.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N0B71_RS04355 | 940767..941174 | + | 408 | WP_259757474.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0B71_RS04360 | 941244..942101 | + | 858 | WP_259757475.1 | alpha/beta hydrolase | - |
N0B71_RS04365 | 942191..942757 | - | 567 | WP_259757476.1 | nucleotidyltransferase family protein | - |
N0B71_RS04370 | 942754..943725 | - | 972 | WP_259757477.1 | XdhC family protein | - |
N0B71_RS04375 | 943729..944940 | - | 1212 | WP_259757478.1 | cytochrome c | - |
N0B71_RS04380 | 944943..945482 | - | 540 | WP_259757479.1 | (2Fe-2S)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15300.57 Da Isoelectric Point: 7.3211
>T256993 WP_259757474.1 NZ_CP104011:940767-941174 [Pseudomonas sp. GCEP-101]
VKYLLDTNILIYLLKNRPESVAQRVNALPADASLNMSFFTYAELLKGAERSSRKAEVLRQLDRLTRQVPVIYDGTARLCE
HYAVHFTRLKQAGTPIGANDLWIACHALALDATLVTHNTREFERIDGLMLEDWAS
VKYLLDTNILIYLLKNRPESVAQRVNALPADASLNMSFFTYAELLKGAERSSRKAEVLRQLDRLTRQVPVIYDGTARLCE
HYAVHFTRLKQAGTPIGANDLWIACHALALDATLVTHNTREFERIDGLMLEDWAS
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|