Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 779504..780065 | Replicon | chromosome |
Accession | NZ_CP104009 | ||
Organism | Mycoplasma feriruminatoris strain L15220 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI15220_RS03395 | Protein ID | WP_278287774.1 |
Coordinates | 779504..779800 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | L5LA09 |
Locus tag | MFERI15220_RS03400 | Protein ID | WP_008362623.1 |
Coordinates | 779793..780065 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI15220_RS03375 (MFERI15220_00673) | 774648..775277 | + | 630 | WP_278287770.1 | beta-phosphoglucomutase | - |
MFERI15220_RS03380 (MFERI15220_00674) | 775384..777012 | + | 1629 | WP_278287771.1 | LppA family lipoprotein | - |
MFERI15220_RS03385 (MFERI15220_00675) | 777044..777925 | - | 882 | WP_278287772.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI15220_RS03390 (MFERI15220_00676) | 778174..779469 | + | 1296 | WP_278287773.1 | ATP-binding protein | - |
MFERI15220_RS03395 (MFERI15220_00677) | 779504..779800 | - | 297 | WP_278287774.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI15220_RS03400 (MFERI15220_00678) | 779793..780065 | - | 273 | WP_008362623.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI15220_RS03405 (MFERI15220_00679) | 780250..781419 | - | 1170 | WP_278287775.1 | site-specific DNA-methyltransferase | - |
MFERI15220_RS03410 (MFERI15220_00680) | 781572..784697 | - | 3126 | WP_278287776.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11452.38 Da Isoelectric Point: 9.8106
>T256992 WP_278287774.1 NZ_CP104009:c779800-779504 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILTQGKELDAKYQDHSLTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILTQGKELDAKYQDHSLTGIYKEYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|