Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 821320..821881 | Replicon | chromosome |
Accession | NZ_CP104008 | ||
Organism | Mycoplasma feriruminatoris strain L14822 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MFERI14822_RS03535 | Protein ID | WP_278307434.1 |
Coordinates | 821320..821616 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | MFERI14822_RS03540 | Protein ID | WP_278300265.1 |
Coordinates | 821609..821881 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MFERI14822_RS03515 (MFERI14822_00702) | 816459..817088 | + | 630 | WP_278299862.1 | beta-phosphoglucomutase | - |
MFERI14822_RS03520 (MFERI14822_00703) | 817196..818827 | + | 1632 | WP_278307433.1 | LppA family lipoprotein | - |
MFERI14822_RS03525 (MFERI14822_00704) | 818860..819741 | - | 882 | WP_278287772.1 | Cof-type HAD-IIB family hydrolase | - |
MFERI14822_RS03530 (MFERI14822_00705) | 819990..821285 | + | 1296 | WP_278300263.1 | ATP-binding protein | - |
MFERI14822_RS03535 (MFERI14822_00706) | 821320..821616 | - | 297 | WP_278307434.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
MFERI14822_RS03540 (MFERI14822_00707) | 821609..821881 | - | 273 | WP_278300265.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MFERI14822_RS03545 (MFERI14822_00708) | 822065..823234 | - | 1170 | WP_278307435.1 | site-specific DNA-methyltransferase | - |
MFERI14822_RS03550 (MFERI14822_00709) | 823400..826507 | - | 3108 | WP_278307436.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11392.37 Da Isoelectric Point: 9.9386
>T256991 WP_278307434.1 NZ_CP104008:c821616-821320 [Mycoplasma feriruminatoris]
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKGYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
MTKYKIVTTKFKKDLKLAKKQNKDLNKLDYVINILIQGKELDAKYQDHSLTGIYKGYRECHIDPDLLIYKKDDDKIVIIM
LRLGSHSNLFEKQKNY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|