Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4327009..4327627 | Replicon | chromosome |
| Accession | NZ_CP104006 | ||
| Organism | Yersinia alsatica strain SCPM-O-B-7604 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | N0H69_RS19595 | Protein ID | WP_002208622.1 |
| Coordinates | 4327424..4327627 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A857F2E4 |
| Locus tag | N0H69_RS19590 | Protein ID | WP_004392643.1 |
| Coordinates | 4327009..4327377 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0H69_RS19560 (N0H69_19560) | 4322680..4322940 | + | 261 | WP_050077358.1 | type B 50S ribosomal protein L31 | - |
| N0H69_RS19565 (N0H69_19565) | 4322956..4323099 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| N0H69_RS19570 (N0H69_19570) | 4323228..4324106 | - | 879 | WP_050151542.1 | metal ABC transporter substrate-binding protein | - |
| N0H69_RS19575 (N0H69_19575) | 4324135..4324992 | - | 858 | WP_050151544.1 | metal ABC transporter permease | - |
| N0H69_RS19580 (N0H69_19580) | 4324989..4325723 | - | 735 | WP_050133694.1 | ABC transporter ATP-binding protein | - |
| N0H69_RS19585 (N0H69_19585) | 4326497..4326850 | + | 354 | WP_050108920.1 | hypothetical protein | - |
| N0H69_RS19590 (N0H69_19590) | 4327009..4327377 | + | 369 | WP_004392643.1 | Hha toxicity modulator TomB | Antitoxin |
| N0H69_RS19595 (N0H69_19595) | 4327424..4327627 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| N0H69_RS19600 (N0H69_19600) | 4328429..4328770 | + | 342 | WP_050151547.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| N0H69_RS19605 (N0H69_19605) | 4329089..4330378 | + | 1290 | WP_050151549.1 | arsenic transporter | - |
| N0H69_RS19610 (N0H69_19610) | 4330457..4330885 | + | 429 | WP_050151551.1 | glutaredoxin-dependent arsenate reductase | - |
| N0H69_RS19615 (N0H69_19615) | 4330976..4331479 | + | 504 | WP_050151553.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T256990 WP_002208622.1 NZ_CP104006:4327424-4327627 [Yersinia alsatica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14176.95 Da Isoelectric Point: 4.5140
>AT256990 WP_004392643.1 NZ_CP104006:4327009-4327377 [Yersinia alsatica]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|