Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 2864056..2864719 | Replicon | chromosome |
Accession | NZ_CP104006 | ||
Organism | Yersinia alsatica strain SCPM-O-B-7604 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0T9T9C7 |
Locus tag | N0H69_RS12740 | Protein ID | WP_050152171.1 |
Coordinates | 2864375..2864719 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | N0H69_RS12735 | Protein ID | WP_050135326.1 |
Coordinates | 2864056..2864373 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0H69_RS12700 (N0H69_12700) | 2860251..2860685 | - | 435 | Protein_2482 | phage tail protein | - |
N0H69_RS12705 (N0H69_12705) | 2860896..2861210 | + | 315 | WP_050152175.1 | hypothetical protein | - |
N0H69_RS12710 (N0H69_12710) | 2861411..2861707 | - | 297 | WP_050152174.1 | NadS family protein | - |
N0H69_RS12715 (N0H69_12715) | 2861782..2862099 | - | 318 | WP_050121413.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N0H69_RS12720 (N0H69_12720) | 2862240..2862440 | - | 201 | WP_050152173.1 | hypothetical protein | - |
N0H69_RS12725 (N0H69_12725) | 2863010..2863195 | - | 186 | WP_050152172.1 | transposase | - |
N0H69_RS12730 (N0H69_12730) | 2863241..2863429 | - | 189 | WP_050135328.1 | hypothetical protein | - |
N0H69_RS12735 (N0H69_12735) | 2864056..2864373 | - | 318 | WP_050135326.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N0H69_RS12740 (N0H69_12740) | 2864375..2864719 | - | 345 | WP_050152171.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0H69_RS12745 (N0H69_12745) | 2865956..2866155 | + | 200 | Protein_2491 | hypothetical protein | - |
N0H69_RS12750 (N0H69_12750) | 2866385..2868145 | + | 1761 | Protein_2492 | autotransporter outer membrane beta-barrel domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | flmH | 2619139..2972621 | 353482 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12552.42 Da Isoelectric Point: 9.7663
>T256988 WP_050152171.1 NZ_CP104006:c2864719-2864375 [Yersinia alsatica]
MKPLYWVGSSKKDLQSLPEDVQDIFGYGLHLSQMGGKHSQAKPLKGFGGAGVLEVVEDYIGETYRAVYTVKFGHAVYVLH
AFQKKSSSGITTPKPDMDKIRERLKIAESHAKGA
MKPLYWVGSSKKDLQSLPEDVQDIFGYGLHLSQMGGKHSQAKPLKGFGGAGVLEVVEDYIGETYRAVYTVKFGHAVYVLH
AFQKKSSSGITTPKPDMDKIRERLKIAESHAKGA
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|