Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3939980..3940637 | Replicon | chromosome |
| Accession | NZ_CP104001 | ||
| Organism | Enterobacter roggenkampii strain RX.G5M56 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | N0B38_RS18680 | Protein ID | WP_021242050.1 |
| Coordinates | 3939980..3940390 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | N0B38_RS18685 | Protein ID | WP_006178375.1 |
| Coordinates | 3940371..3940637 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0B38_RS18660 (N0B38_18660) | 3935973..3937706 | - | 1734 | WP_135345484.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N0B38_RS18665 (N0B38_18665) | 3937712..3938425 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N0B38_RS18670 (N0B38_18670) | 3938454..3939350 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
| N0B38_RS18675 (N0B38_18675) | 3939452..3939973 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
| N0B38_RS18680 (N0B38_18680) | 3939980..3940390 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
| N0B38_RS18685 (N0B38_18685) | 3940371..3940637 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| N0B38_RS18690 (N0B38_18690) | 3940932..3941912 | + | 981 | WP_008499712.1 | tRNA-modifying protein YgfZ | - |
| N0B38_RS18695 (N0B38_18695) | 3941997..3942656 | - | 660 | WP_021242052.1 | hemolysin III family protein | - |
| N0B38_RS18700 (N0B38_18700) | 3942922..3943653 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
| N0B38_RS18705 (N0B38_18705) | 3943770..3945203 | + | 1434 | WP_023294510.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T256978 WP_021242050.1 NZ_CP104001:c3940390-3939980 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |