Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1069596..1070216 | Replicon | chromosome |
Accession | NZ_CP104001 | ||
Organism | Enterobacter roggenkampii strain RX.G5M56 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | N0B38_RS04915 | Protein ID | WP_008499287.1 |
Coordinates | 1069596..1069814 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | N0B38_RS04920 | Protein ID | WP_008499288.1 |
Coordinates | 1069842..1070216 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B38_RS04885 (N0B38_04885) | 1065609..1065869 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
N0B38_RS04890 (N0B38_04890) | 1065872..1066012 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
N0B38_RS04895 (N0B38_04895) | 1066009..1066719 | - | 711 | WP_135345885.1 | GNAT family protein | - |
N0B38_RS04900 (N0B38_04900) | 1066821..1068281 | + | 1461 | WP_008499284.1 | PLP-dependent aminotransferase family protein | - |
N0B38_RS04905 (N0B38_04905) | 1068253..1068720 | - | 468 | WP_059362219.1 | YlaC family protein | - |
N0B38_RS04910 (N0B38_04910) | 1068838..1069389 | - | 552 | WP_045416680.1 | maltose O-acetyltransferase | - |
N0B38_RS04915 (N0B38_04915) | 1069596..1069814 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
N0B38_RS04920 (N0B38_04920) | 1069842..1070216 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
N0B38_RS04925 (N0B38_04925) | 1070726..1073872 | - | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N0B38_RS04930 (N0B38_04930) | 1073895..1075088 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T256972 WP_008499287.1 NZ_CP104001:c1069814-1069596 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT256972 WP_008499288.1 NZ_CP104001:c1070216-1069842 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |