Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 596694..597273 | Replicon | chromosome |
| Accession | NZ_CP104001 | ||
| Organism | Enterobacter roggenkampii strain RX.G5M56 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A656ULU9 |
| Locus tag | N0B38_RS02750 | Protein ID | WP_025912099.1 |
| Coordinates | 596694..596981 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | N0B38_RS02755 | Protein ID | WP_039023943.1 |
| Coordinates | 596968..597273 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0B38_RS02720 (N0B38_02720) | 591707..591823 | + | 117 | Protein_525 | amino acid-binding protein | - |
| N0B38_RS02725 (N0B38_02725) | 591816..592511 | + | 696 | WP_032664591.1 | winged helix-turn-helix domain-containing protein | - |
| N0B38_RS02730 (N0B38_02730) | 592657..593127 | + | 471 | WP_008501325.1 | MarR family transcriptional regulator | - |
| N0B38_RS02735 (N0B38_02735) | 593124..594191 | + | 1068 | WP_085930304.1 | HlyD family secretion protein | - |
| N0B38_RS02740 (N0B38_02740) | 594181..595257 | + | 1077 | WP_023293361.1 | DUF2955 domain-containing protein | - |
| N0B38_RS02745 (N0B38_02745) | 595254..596525 | - | 1272 | WP_126348752.1 | DUF445 domain-containing protein | - |
| N0B38_RS02750 (N0B38_02750) | 596694..596981 | + | 288 | WP_025912099.1 | BrnT family toxin | Toxin |
| N0B38_RS02755 (N0B38_02755) | 596968..597273 | + | 306 | WP_039023943.1 | BrnA antitoxin family protein | Antitoxin |
| N0B38_RS02760 (N0B38_02760) | 597300..597938 | - | 639 | WP_259493313.1 | LysE family translocator | - |
| N0B38_RS02765 (N0B38_02765) | 597986..598729 | - | 744 | WP_021240616.1 | AraC family transcriptional regulator | - |
| N0B38_RS02770 (N0B38_02770) | 598881..600251 | + | 1371 | WP_135345794.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| N0B38_RS02775 (N0B38_02775) | 600297..600617 | - | 321 | WP_008501314.1 | hypothetical protein | - |
| N0B38_RS02780 (N0B38_02780) | 600617..601162 | - | 546 | WP_008501313.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11235.68 Da Isoelectric Point: 7.4007
>T256971 WP_025912099.1 NZ_CP104001:596694-596981 [Enterobacter roggenkampii]
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|