Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 16221..16740 | Replicon | plasmid p3 |
Accession | NZ_CP104000 | ||
Organism | Ketogulonicigenium vulgare strain D3_3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NZF41_RS16475 | Protein ID | WP_273692383.1 |
Coordinates | 16221..16505 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NZF41_RS16480 | Protein ID | WP_273692385.1 |
Coordinates | 16495..16740 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZF41_RS16455 | 11667..13211 | - | 1545 | WP_273692379.1 | class I SAM-dependent DNA methyltransferase | - |
NZF41_RS16460 | 13798..14637 | + | 840 | WP_273692380.1 | PRC-barrel domain-containing protein | - |
NZF41_RS16465 | 14667..15044 | + | 378 | WP_273692381.1 | PRC-barrel domain-containing protein | - |
NZF41_RS16470 | 15094..15543 | - | 450 | WP_273692382.1 | TspO/MBR family protein | - |
NZF41_RS16475 | 16221..16505 | - | 285 | WP_273692383.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NZF41_RS16480 | 16495..16740 | - | 246 | WP_273692385.1 | antitoxin | Antitoxin |
NZF41_RS16485 | 17423..17773 | + | 351 | WP_273692386.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
NZF41_RS16490 | 17787..18137 | + | 351 | WP_273692348.1 | DUF983 domain-containing protein | - |
NZF41_RS16495 | 18476..19135 | + | 660 | WP_273692350.1 | HAD family phosphatase | - |
NZF41_RS16500 | 19371..19796 | + | 426 | WP_273692352.1 | VOC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..35511 | 35511 | |
- | flank | IS/Tn | - | - | 20265..20612 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10847.74 Da Isoelectric Point: 10.7301
>T256969 WP_273692383.1 NZ_CP104000:c16505-16221 [Ketogulonicigenium vulgare]
MSYKLEFLPSALKEWRKLDSVIADQFRRKLLKLRDNPRVSSLALRNLKDCYKVKLASAGFRLVYQVVDDRMIVQVVAVGK
RSNGDVYDTASKRV
MSYKLEFLPSALKEWRKLDSVIADQFRRKLLKLRDNPRVSSLALRNLKDCYKVKLASAGFRLVYQVVDDRMIVQVVAVGK
RSNGDVYDTASKRV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|