Detailed information of TA system TA256967

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): BrnTA/BrnT-BrnA
• Location: 2492819..2493354
• Replicon: chromosome
• Accession: NZ_CP103997
• Organism: Ketogulonicigenium vulgare strain D3_3

Toxin (Protein)

• Gene name: brnT
• Uniprot ID: -
• Locus tag: NZF41_RS12645
• Protein ID: WP_013384044.1
• Coordinates: 2492819..2493067 (+)
• Length: 83 a.a.

Antitoxin (Protein)

• Gene name: brnA
• Uniprot ID: -
• Locus tag: NZF41_RS12650
• Protein ID: WP_273688971.1
• Coordinates: 2493064..2493354 (+)
• Length: 97 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NZF41_RS12610	2488048..2489064	+	1017	WP_273688959.1	iron chelate uptake ABC transporter family permease subunit	-
NZF41_RS12615	2489284..2489448	+	165	WP_273688961.1	hypothetical protein	-
NZF41_RS12620	2489865..2490791	+	927	WP_273688963.1	SDR family NAD(P)-dependent oxidoreductase	-
NZF41_RS12625	2491164..2491550	+	387	WP_273691726.1	sigma factor-like helix-turn-helix DNA-binding protein	-
NZF41_RS12630	2491605..2491841	-	237	WP_273688965.1	hypothetical protein	-
NZF41_RS12635	2491956..2492177	-	222	WP_273688967.1	hypothetical protein	-
NZF41_RS12640	2492181..2492723	-	543	WP_273688969.1	lysozyme	-
NZF41_RS12645	2492819..2493067	+	249	WP_013384044.1	BrnT family toxin	Toxin
NZF41_RS12650	2493064..2493354	+	291	WP_273688971.1	BrnA antitoxin family protein	Antitoxin
NZF41_RS12655	2493366..2493593	-	228	WP_273688973.1	hypothetical protein	-
NZF41_RS12660	2493608..2494921	-	1314	WP_273688975.1	hypothetical protein	-
NZF41_RS12665	2494921..2495184	-	264	WP_014537874.1	hypothetical protein	-
NZF41_RS12670	2495356..2496177	-	822	WP_273688978.1	manganese catalase family protein	-
NZF41_RS12675	2496262..2496759	-	498	WP_273688980.1	ferritin-like domain-containing protein	-
NZF41_RS12680	2496777..2497292	-	516	WP_273688982.1	ferritin-like domain-containing protein	-
NZF41_RS12685	2497549..2497815	-	267	WP_273688984.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2492181..2530848	38667

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-78)

Antitoxin

• BrnA antitoxin of type II toxin-antitoxin system (20-94)

Sequences

Toxin

Protein

• Length: 83 a.a.
• Molecular weight: 9028.54 Da
• Isoelectric Point: 7.3199

>T256967 WP_013384044.1 NZ_CP103997:2492819-2493067 [Ketogulonicigenium vulgare]
MMMIVWDEPKRESNLEKHGLDFADLSEEFFLSSVVVPAKNGRHMAIGKLADGTIAVVFATLGTQGLSVISMRHASKKERA
IL

Nucleotide

• Length: 249 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10549.03 Da
• Isoelectric Point: 10.4185

>AT256967 WP_273688971.1 NZ_CP103997:2493064-2493354 [Ketogulonicigenium vulgare]
MKANKLTEKEIQRRIASDPDAPEATDDQLAKAKPFAEALPQLAENLRRNLGGRPKSDNPKVAVSLRLDQDVIEKFKAAGP
GWQSRMNKALREAAGV

Nucleotide

• Length: 291 bp