256966

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1430122..1430769 Replicon chromosome
Accession NZ_CP103997
Organism Ketogulonicigenium vulgare strain D3_3

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NZF41_RS07255 Protein ID WP_273687133.1
Coordinates 1430581..1430769 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NZF41_RS07250 Protein ID WP_273687131.1
Coordinates 1430122..1430523 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZF41_RS07210 1425891..1426319 + 429 WP_273687116.1 tail fiber assembly protein -
NZF41_RS07215 1426338..1426742 + 405 WP_273687118.1 hypothetical protein -
NZF41_RS07220 1426739..1427233 + 495 WP_273687120.1 hypothetical protein -
NZF41_RS07225 1427269..1427526 + 258 WP_273687122.1 hypothetical protein -
NZF41_RS07230 1427650..1427982 - 333 WP_273687123.1 hypothetical protein -
NZF41_RS07235 1428318..1428548 + 231 WP_236953076.1 hypothetical protein -
NZF41_RS07240 1428548..1429861 + 1314 WP_273687127.1 hypothetical protein -
NZF41_RS07245 1429876..1430103 + 228 WP_273687129.1 hypothetical protein -
NZF41_RS07250 1430122..1430523 - 402 WP_273687131.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NZF41_RS07255 1430581..1430769 - 189 WP_273687133.1 type II toxin-antitoxin system HicA family toxin Toxin
NZF41_RS07260 1430911..1431453 + 543 WP_273687135.1 lysozyme -
NZF41_RS07265 1431456..1431659 + 204 WP_273687137.1 hypothetical protein -
NZF41_RS07270 1431801..1432016 + 216 WP_273687139.1 hypothetical protein -
NZF41_RS07275 1432179..1432988 + 810 WP_273687141.1 DNA adenine methylase -
NZF41_RS07280 1433102..1433458 + 357 WP_273687143.1 metalloregulator ArsR/SmtB family transcription factor -
NZF41_RS07285 1433461..1433886 + 426 WP_273687145.1 arsenate reductase (glutaredoxin) -
NZF41_RS07290 1433886..1434929 + 1044 WP_273687147.1 ACR3 family arsenite efflux transporter -
NZF41_RS07295 1434926..1435615 + 690 WP_273687149.1 arsenical resistance protein ArsH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1399544..1433458 33914
- inside Prophage - - 1399544..1438419 38875


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(8-61)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7008.33 Da        Isoelectric Point: 10.7274

>T256966 WP_273687133.1 NZ_CP103997:c1430769-1430581 [Ketogulonicigenium vulgare]
MELETNSRKLLKVLKDAGFEEISKRGSHLKLRKGDRIVILPHPKKDLPLGTVKSIYQQAGLL

Download         Length: 189 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14287.19 Da        Isoelectric Point: 4.4109

>AT256966 WP_273687131.1 NZ_CP103997:c1430523-1430122 [Ketogulonicigenium vulgare]
VRYFTAIIHKDEGSAYGLTFPDLPGAFAAADTWDDIPKAATEALDLWFEDQPDVAPASLDAVRARPEVAAELAEGAVLMP
VPYIAADTALERVNISIERGLLRAIDETAKSRKMTRSSFLASAARRELVGAGL

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References