Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1438197..1439113 | Replicon | chromosome |
Accession | NZ_CP103995 | ||
Organism | Bacillus subtilis strain SRCM117109 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | N0B18_RS07710 | Protein ID | WP_003244695.1 |
Coordinates | 1438367..1439113 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | N0B18_RS07705 | Protein ID | WP_003232646.1 |
Coordinates | 1438197..1438367 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B18_RS07670 (N0B18_07670) | 1435056..1435385 | + | 330 | WP_046160312.1 | XkdW family protein | - |
N0B18_RS07675 (N0B18_07675) | 1435382..1435546 | + | 165 | WP_014479563.1 | XkdX family protein | - |
N0B18_RS07680 (N0B18_07680) | 1435593..1436432 | + | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
N0B18_RS07685 (N0B18_07685) | 1436485..1436754 | + | 270 | WP_069964126.1 | hemolysin XhlA family protein | - |
N0B18_RS07690 (N0B18_07690) | 1436767..1437030 | + | 264 | WP_014479566.1 | phage holin | - |
N0B18_RS07695 (N0B18_07695) | 1437043..1437936 | + | 894 | WP_021479459.1 | N-acetylmuramoyl-L-alanine amidase | - |
N0B18_RS07700 (N0B18_07700) | 1437974..1438111 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
N0B18_RS07705 (N0B18_07705) | 1438197..1438367 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
N0B18_RS07710 (N0B18_07710) | 1438367..1439113 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
N0B18_RS07715 (N0B18_07715) | 1439223..1440224 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
N0B18_RS07720 (N0B18_07720) | 1440237..1440854 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
N0B18_RS07725 (N0B18_07725) | 1441130..1442438 | - | 1309 | Protein_1459 | serine/threonine exchanger | - |
N0B18_RS07730 (N0B18_07730) | 1442827..1443777 | + | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
N0B18_RS07735 (N0B18_07735) | 1443886..1443981 | + | 96 | Protein_1461 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1403204..1503689 | 100485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T256965 WP_003244695.1 NZ_CP103995:c1439113-1438367 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|