Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 519591..520227 | Replicon | chromosome |
| Accession | NZ_CP103995 | ||
| Organism | Bacillus subtilis strain SRCM117109 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | N0B18_RS02650 | Protein ID | WP_003156187.1 |
| Coordinates | 519877..520227 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | N0B18_RS02645 | Protein ID | WP_003225183.1 |
| Coordinates | 519591..519872 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0B18_RS02625 (N0B18_02625) | 515950..516549 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
| N0B18_RS02630 (N0B18_02630) | 516644..517009 | + | 366 | WP_069963989.1 | holo-ACP synthase | - |
| N0B18_RS02635 (N0B18_02635) | 517175..518191 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| N0B18_RS02640 (N0B18_02640) | 518306..519475 | + | 1170 | WP_015252766.1 | alanine racemase | - |
| N0B18_RS02645 (N0B18_02645) | 519591..519872 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| N0B18_RS02650 (N0B18_02650) | 519877..520227 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| N0B18_RS02655 (N0B18_02655) | 520343..521167 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| N0B18_RS02660 (N0B18_02660) | 521172..521537 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| N0B18_RS02665 (N0B18_02665) | 521541..521942 | + | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
| N0B18_RS02670 (N0B18_02670) | 521954..522961 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| N0B18_RS02675 (N0B18_02675) | 523023..523352 | + | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
| N0B18_RS02680 (N0B18_02680) | 523349..523831 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| N0B18_RS02685 (N0B18_02685) | 523797..524585 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| N0B18_RS02690 (N0B18_02690) | 524585..525184 | + | 600 | WP_021481701.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256964 WP_003156187.1 NZ_CP103995:519877-520227 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|