Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2344869..2345530 | Replicon | chromosome |
Accession | NZ_CP103983 | ||
Organism | Cysteiniphilum sp. QT6929 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYP54_RS10225 | Protein ID | WP_283156418.1 |
Coordinates | 2345111..2345530 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYP54_RS10220 | Protein ID | WP_283156417.1 |
Coordinates | 2344869..2345111 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP54_RS10205 (NYP54_10210) | 2342204..2342590 | - | 387 | WP_283156415.1 | type II toxin-antitoxin system VapC family toxin | - |
NYP54_RS10210 (NYP54_10215) | 2342591..2342827 | - | 237 | WP_151193431.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NYP54_RS10215 (NYP54_10220) | 2342909..2344480 | - | 1572 | WP_283156416.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
NYP54_RS10220 (NYP54_10225) | 2344869..2345111 | + | 243 | WP_283156417.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NYP54_RS10225 (NYP54_10230) | 2345111..2345530 | + | 420 | WP_283156418.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NYP54_RS10230 (NYP54_10235) | 2345728..2347404 | - | 1677 | WP_283156419.1 | energy-dependent translational throttle protein EttA | - |
NYP54_RS10235 (NYP54_10240) | 2347547..2348686 | - | 1140 | WP_283156420.1 | Na+/H+ antiporter NhaA | - |
NYP54_RS10240 (NYP54_10245) | 2348753..2349355 | - | 603 | WP_283156421.1 | TetR family transcriptional regulator | - |
NYP54_RS10245 (NYP54_10250) | 2349446..2349715 | - | 270 | WP_117003179.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15522.19 Da Isoelectric Point: 7.3501
>T256963 WP_283156418.1 NZ_CP103983:2345111-2345530 [Cysteiniphilum sp. QT6929]
MVNTKRYMLDTNTASYIIKGDYPALKTHLINVPMSSICISAITEAELLLGVAKKLSAKHLPMIVNEFLLRVEILPWTSQA
AKVYAKLRATCEKEGKTLSCMDMLIAAHAKAENAVLVTKDGAFYHLSKHLELEDWTNDE
MVNTKRYMLDTNTASYIIKGDYPALKTHLINVPMSSICISAITEAELLLGVAKKLSAKHLPMIVNEFLLRVEILPWTSQA
AKVYAKLRATCEKEGKTLSCMDMLIAAHAKAENAVLVTKDGAFYHLSKHLELEDWTNDE
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|