Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 2057216..2057703 | Replicon | chromosome |
Accession | NZ_CP103983 | ||
Organism | Cysteiniphilum sp. QT6929 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | NYP54_RS08960 | Protein ID | WP_283156214.1 |
Coordinates | 2057434..2057703 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | NYP54_RS08955 | Protein ID | WP_283156213.1 |
Coordinates | 2057216..2057434 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP54_RS08935 (NYP54_08935) | 2053028..2053537 | + | 510 | WP_283156209.1 | hypothetical protein | - |
NYP54_RS08940 (NYP54_08940) | 2053717..2054178 | - | 462 | WP_283156210.1 | hypothetical protein | - |
NYP54_RS08945 (NYP54_08945) | 2054371..2055453 | - | 1083 | WP_283156211.1 | LysM domain-containing protein | - |
NYP54_RS08950 (NYP54_08950) | 2055517..2057070 | - | 1554 | WP_283156212.1 | murein biosynthesis integral membrane protein MurJ | - |
NYP54_RS08955 (NYP54_08955) | 2057216..2057434 | + | 219 | WP_283156213.1 | DUF6290 family protein | Antitoxin |
NYP54_RS08960 (NYP54_08960) | 2057434..2057703 | + | 270 | WP_283156214.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP54_RS08965 (NYP54_08965) | 2057797..2059200 | - | 1404 | WP_283156215.1 | asparagine--tRNA ligase | - |
NYP54_RS08970 (NYP54_08970) | 2059674..2060561 | + | 888 | WP_151192831.1 | glycine--tRNA ligase subunit alpha | - |
NYP54_RS08975 (NYP54_08975) | 2060558..2060743 | - | 186 | WP_283156216.1 | hypothetical protein | - |
NYP54_RS08980 (NYP54_08980) | 2060835..2062286 | + | 1452 | WP_283156217.1 | potassium transporter TrkG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10497.23 Da Isoelectric Point: 10.6462
>T256962 WP_283156214.1 NZ_CP103983:2057434-2057703 [Cysteiniphilum sp. QT6929]
MWRVVFDKKAEKQFNGLDSQVKKRIAKFIDERLIPSSDPRDLGKPLVGKSFGNHIRFRIGDYRLICDIQDQEITVLVLRI
GHRREIYRG
MWRVVFDKKAEKQFNGLDSQVKKRIAKFIDERLIPSSDPRDLGKPLVGKSFGNHIRFRIGDYRLICDIQDQEITVLVLRI
GHRREIYRG
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|