Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 1581864..1582399 Replicon chromosome
Accession NZ_CP103983
Organism Cysteiniphilum sp. QT6929

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NYP54_RS06885 Protein ID WP_283155891.1
Coordinates 1581864..1582190 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag NYP54_RS06890 Protein ID WP_283155892.1
Coordinates 1582187..1582399 (-) Length 71 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP54_RS06845 (NYP54_06845) 1576887..1577441 - 555 WP_283155884.1 L-threonylcarbamoyladenylate synthase -
NYP54_RS06850 (NYP54_06850) 1577629..1578012 + 384 WP_151194276.1 hypothetical protein -
NYP54_RS06855 (NYP54_06855) 1578019..1578660 + 642 WP_283155885.1 phosphoribosylanthranilate isomerase -
NYP54_RS06860 (NYP54_06860) 1578653..1579015 + 363 WP_283155886.1 hydroxymyristoyl-ACP dehydratase -
NYP54_RS06865 (NYP54_06865) 1579012..1579761 + 750 WP_283155887.1 glycosyltransferase family 2 protein -
NYP54_RS06870 (NYP54_06870) 1579802..1580752 + 951 WP_283155888.1 hypothetical protein -
NYP54_RS06875 (NYP54_06875) 1580742..1581167 + 426 WP_283155889.1 thioesterase family protein -
NYP54_RS06880 (NYP54_06880) 1581160..1581789 + 630 WP_283155890.1 outer membrane lipoprotein carrier protein LolA -
NYP54_RS06885 (NYP54_06885) 1581864..1582190 - 327 WP_283155891.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NYP54_RS06890 (NYP54_06890) 1582187..1582399 - 213 WP_283155892.1 antitoxin MazE family protein Antitoxin
NYP54_RS06895 (NYP54_06895) 1582487..1583287 - 801 WP_283155893.1 shikimate dehydrogenase -
NYP54_RS06900 (NYP54_06900) 1583376..1584266 - 891 WP_283155894.1 arginase -
NYP54_RS06905 (NYP54_06905) 1584259..1585332 - 1074 WP_283155895.1 ornithine cyclodeaminase -
NYP54_RS06910 (NYP54_06910) 1585532..1586641 - 1110 WP_283155896.1 DNA polymerase III subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-103)

Antitoxin

Antitoxin MazE-like

(7-69)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 12071.11 Da        Isoelectric Point: 10.1468

>T256961 WP_283155891.1 NZ_CP103983:c1582190-1581864 [Cysteiniphilum sp. QT6929]
VIKRGDLVTVSLRGDYGKPRPALVIQSDLFAEHPSVTILPVTSEIRETPLFRYTVKASEINGLMKTSQVMIDKLHTVTRE
QIGAPFGRLNRNNLLEIERLLSVFIGIA

Download         Length: 327 bp

Antitoxin


Download         Length: 71 a.a.        Molecular weight: 8505.61 Da        Isoelectric Point: 6.9798

>AT256961 WP_283155892.1 NZ_CP103983:c1582399-1582187 [Cysteiniphilum sp. QT6929]
MPRSIQERVKKHRDELKAQGLRPLQIWVPDTRKYGFKEECLRQSKLLLNDQYERDTMDWLDDASDNEGWK

Download         Length: 213 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References