Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 1581864..1582399 | Replicon | chromosome |
Accession | NZ_CP103983 | ||
Organism | Cysteiniphilum sp. QT6929 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NYP54_RS06885 | Protein ID | WP_283155891.1 |
Coordinates | 1581864..1582190 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NYP54_RS06890 | Protein ID | WP_283155892.1 |
Coordinates | 1582187..1582399 (-) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP54_RS06845 (NYP54_06845) | 1576887..1577441 | - | 555 | WP_283155884.1 | L-threonylcarbamoyladenylate synthase | - |
NYP54_RS06850 (NYP54_06850) | 1577629..1578012 | + | 384 | WP_151194276.1 | hypothetical protein | - |
NYP54_RS06855 (NYP54_06855) | 1578019..1578660 | + | 642 | WP_283155885.1 | phosphoribosylanthranilate isomerase | - |
NYP54_RS06860 (NYP54_06860) | 1578653..1579015 | + | 363 | WP_283155886.1 | hydroxymyristoyl-ACP dehydratase | - |
NYP54_RS06865 (NYP54_06865) | 1579012..1579761 | + | 750 | WP_283155887.1 | glycosyltransferase family 2 protein | - |
NYP54_RS06870 (NYP54_06870) | 1579802..1580752 | + | 951 | WP_283155888.1 | hypothetical protein | - |
NYP54_RS06875 (NYP54_06875) | 1580742..1581167 | + | 426 | WP_283155889.1 | thioesterase family protein | - |
NYP54_RS06880 (NYP54_06880) | 1581160..1581789 | + | 630 | WP_283155890.1 | outer membrane lipoprotein carrier protein LolA | - |
NYP54_RS06885 (NYP54_06885) | 1581864..1582190 | - | 327 | WP_283155891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYP54_RS06890 (NYP54_06890) | 1582187..1582399 | - | 213 | WP_283155892.1 | antitoxin MazE family protein | Antitoxin |
NYP54_RS06895 (NYP54_06895) | 1582487..1583287 | - | 801 | WP_283155893.1 | shikimate dehydrogenase | - |
NYP54_RS06900 (NYP54_06900) | 1583376..1584266 | - | 891 | WP_283155894.1 | arginase | - |
NYP54_RS06905 (NYP54_06905) | 1584259..1585332 | - | 1074 | WP_283155895.1 | ornithine cyclodeaminase | - |
NYP54_RS06910 (NYP54_06910) | 1585532..1586641 | - | 1110 | WP_283155896.1 | DNA polymerase III subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12071.11 Da Isoelectric Point: 10.1468
>T256961 WP_283155891.1 NZ_CP103983:c1582190-1581864 [Cysteiniphilum sp. QT6929]
VIKRGDLVTVSLRGDYGKPRPALVIQSDLFAEHPSVTILPVTSEIRETPLFRYTVKASEINGLMKTSQVMIDKLHTVTRE
QIGAPFGRLNRNNLLEIERLLSVFIGIA
VIKRGDLVTVSLRGDYGKPRPALVIQSDLFAEHPSVTILPVTSEIRETPLFRYTVKASEINGLMKTSQVMIDKLHTVTRE
QIGAPFGRLNRNNLLEIERLLSVFIGIA
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|