Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1525660..1526315 | Replicon | chromosome |
Accession | NZ_CP103983 | ||
Organism | Cysteiniphilum sp. QT6929 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYP54_RS06610 | Protein ID | WP_283155847.1 |
Coordinates | 1525896..1526315 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYP54_RS06605 | Protein ID | WP_283155846.1 |
Coordinates | 1525660..1525899 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP54_RS06580 (NYP54_06580) | 1520858..1522876 | - | 2019 | WP_283155841.1 | M3 family metallopeptidase | - |
NYP54_RS06585 (NYP54_06585) | 1522971..1523615 | + | 645 | WP_283155842.1 | site-2 protease family protein | - |
NYP54_RS06590 (NYP54_06590) | 1523631..1524002 | + | 372 | WP_283155843.1 | MTH938/NDUFAF3 family protein | - |
NYP54_RS06595 (NYP54_06595) | 1524149..1524622 | + | 474 | WP_283155844.1 | TUL4 family lipoprotein | - |
NYP54_RS06600 (NYP54_06600) | 1524821..1525471 | - | 651 | WP_283155845.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
NYP54_RS06605 (NYP54_06605) | 1525660..1525899 | + | 240 | WP_283155846.1 | antitoxin | Antitoxin |
NYP54_RS06610 (NYP54_06610) | 1525896..1526315 | + | 420 | WP_283155847.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NYP54_RS06615 (NYP54_06615) | 1526393..1526644 | + | 252 | WP_117001514.1 | hypothetical protein | - |
NYP54_RS06620 (NYP54_06620) | 1526681..1528423 | + | 1743 | WP_283155848.1 | proline--tRNA ligase | - |
NYP54_RS06625 (NYP54_06625) | 1528493..1529467 | + | 975 | WP_283155849.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
NYP54_RS06630 (NYP54_06630) | 1529566..1529823 | - | 258 | WP_117001517.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15229.74 Da Isoelectric Point: 5.1594
>T256960 WP_283155847.1 NZ_CP103983:1525896-1526315 [Cysteiniphilum sp. QT6929]
MILVDTNVISEPLKPRPNVSVIKWLDDQLIDALYLSTISIAEIRFGIAALPSGKKKTTLEESLESTILPLFTNRVLSFDQ
NAAKIYALSMAKARKCGITVGIADAYIAAIAKANSMTIATRDTNPFDALEVPYINPWEC
MILVDTNVISEPLKPRPNVSVIKWLDDQLIDALYLSTISIAEIRFGIAALPSGKKKTTLEESLESTILPLFTNRVLSFDQ
NAAKIYALSMAKARKCGITVGIADAYIAAIAKANSMTIATRDTNPFDALEVPYINPWEC
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|