Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 715602..716149 | Replicon | chromosome |
| Accession | NZ_CP103983 | ||
| Organism | Cysteiniphilum sp. QT6929 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NYP54_RS03010 | Protein ID | WP_283157110.1 |
| Coordinates | 715602..715889 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NYP54_RS03015 | Protein ID | WP_151193220.1 |
| Coordinates | 715877..716149 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP54_RS02980 (NYP54_02980) | 711087..711932 | + | 846 | WP_283157104.1 | 2OG-Fe(II) oxygenase family protein | - |
| NYP54_RS02985 (NYP54_02985) | 711955..712587 | + | 633 | WP_283157105.1 | phosphatase PAP2 family protein | - |
| NYP54_RS02990 (NYP54_02990) | 712760..713455 | - | 696 | WP_283157106.1 | hypothetical protein | - |
| NYP54_RS02995 (NYP54_02995) | 713471..714088 | - | 618 | WP_283157107.1 | bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE | - |
| NYP54_RS03000 (NYP54_03000) | 714097..714870 | - | 774 | WP_283157108.1 | imidazole glycerol phosphate synthase subunit HisF | - |
| NYP54_RS03005 (NYP54_03005) | 714864..715589 | - | 726 | WP_283157109.1 | 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase | - |
| NYP54_RS03010 (NYP54_03010) | 715602..715889 | - | 288 | WP_283157110.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP54_RS03015 (NYP54_03015) | 715877..716149 | - | 273 | WP_151193220.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| NYP54_RS03020 (NYP54_03020) | 716414..717016 | - | 603 | WP_283157111.1 | imidazole glycerol phosphate synthase subunit HisH | - |
| NYP54_RS03025 (NYP54_03025) | 717013..718083 | - | 1071 | WP_283157112.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| NYP54_RS03030 (NYP54_03030) | 718070..719155 | - | 1086 | WP_283157113.1 | histidinol-phosphate transaminase | - |
| NYP54_RS03035 (NYP54_03035) | 719140..720471 | - | 1332 | WP_283157114.1 | histidinol dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10850.44 Da Isoelectric Point: 7.2403
>T256959 WP_283157110.1 NZ_CP103983:c715889-715602 [Cysteiniphilum sp. QT6929]
MSQIKITEGALQGIQRCQSFLESRNTLASQRAAHEIAKYIQLLKETPEIGRPLSDYLRELIIPFGDSGYAVLYRYEAMTD
ICHVLSFKHQKEAGY
MSQIKITEGALQGIQRCQSFLESRNTLASQRAAHEIAKYIQLLKETPEIGRPLSDYLRELIIPFGDSGYAVLYRYEAMTD
ICHVLSFKHQKEAGY
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|