Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 52308..52833 Replicon plasmid pDLI.6n
Accession NZ_CP103975
Organism Escherichia coli strain DLI.6n

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NZ657_RS24635 Protein ID WP_001159871.1
Coordinates 52528..52833 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NZ657_RS24630 Protein ID WP_000813630.1
Coordinates 52308..52526 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZ657_RS24595 (47677) 47677..49065 - 1389 WP_259583026.1 hypothetical protein -
NZ657_RS24600 (49193) 49193..49381 - 189 WP_000744815.1 hypothetical protein -
NZ657_RS24605 (49729) 49729..50019 + 291 WP_072184881.1 colicin-like pore-forming protein -
NZ657_RS24610 (50037) 50037..50384 - 348 WP_001554926.1 colicin E1 family microcin immunity protein -
NZ657_RS24615 (50495) 50495..50842 + 348 WP_001554927.1 DUF6404 family protein -
NZ657_RS24620 (50860) 50860..51456 - 597 WP_001554928.1 hypothetical protein -
NZ657_RS24625 (51444) 51444..51713 - 270 WP_001554929.1 hypothetical protein -
NZ657_RS24630 (52308) 52308..52526 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NZ657_RS24635 (52528) 52528..52833 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NZ657_RS24640 (52834) 52834..53640 + 807 WP_000016968.1 site-specific integrase -
NZ657_RS24645 (53971) 53971..55317 - 1347 WP_000483767.1 IS4-like element IS4 family transposase -
NZ657_RS24650 (55758) 55758..56453 - 696 WP_001478804.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) - 1..104244 104244
- flank IS/Tn - - 53971..55299 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T256955 WP_001159871.1 NZ_CP103975:52528-52833 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT256955 WP_000813630.1 NZ_CP103975:52308-52526 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References