Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 52308..52833 | Replicon | plasmid pDLI.6n |
| Accession | NZ_CP103975 | ||
| Organism | Escherichia coli strain DLI.6n | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NZ657_RS24635 | Protein ID | WP_001159871.1 |
| Coordinates | 52528..52833 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | NZ657_RS24630 | Protein ID | WP_000813630.1 |
| Coordinates | 52308..52526 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZ657_RS24595 (47677) | 47677..49065 | - | 1389 | WP_259583026.1 | hypothetical protein | - |
| NZ657_RS24600 (49193) | 49193..49381 | - | 189 | WP_000744815.1 | hypothetical protein | - |
| NZ657_RS24605 (49729) | 49729..50019 | + | 291 | WP_072184881.1 | colicin-like pore-forming protein | - |
| NZ657_RS24610 (50037) | 50037..50384 | - | 348 | WP_001554926.1 | colicin E1 family microcin immunity protein | - |
| NZ657_RS24615 (50495) | 50495..50842 | + | 348 | WP_001554927.1 | DUF6404 family protein | - |
| NZ657_RS24620 (50860) | 50860..51456 | - | 597 | WP_001554928.1 | hypothetical protein | - |
| NZ657_RS24625 (51444) | 51444..51713 | - | 270 | WP_001554929.1 | hypothetical protein | - |
| NZ657_RS24630 (52308) | 52308..52526 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NZ657_RS24635 (52528) | 52528..52833 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NZ657_RS24640 (52834) | 52834..53640 | + | 807 | WP_000016968.1 | site-specific integrase | - |
| NZ657_RS24645 (53971) | 53971..55317 | - | 1347 | WP_000483767.1 | IS4-like element IS4 family transposase | - |
| NZ657_RS24650 (55758) | 55758..56453 | - | 696 | WP_001478804.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) | - | 1..104244 | 104244 | |
| - | flank | IS/Tn | - | - | 53971..55299 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T256955 WP_001159871.1 NZ_CP103975:52528-52833 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |