Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 42819..43426 Replicon plasmid pDLI.6n
Accession NZ_CP103975
Organism Escherichia coli strain DLI.6n

Toxin (Protein)


Gene name doc Uniprot ID B7LIH8
Locus tag NZ657_RS24570 Protein ID WP_000673985.1
Coordinates 43040..43426 (+) Length 129 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag NZ657_RS24565 Protein ID WP_259583023.1
Coordinates 42819..43043 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZ657_RS24540 (39053) 39053..39400 + 348 WP_023144239.1 metalloregulator ArsR/SmtB family transcription factor -
NZ657_RS24545 (39943) 39943..40152 + 210 WP_024192676.1 hypothetical protein -
NZ657_RS24550 (40218) 40218..40472 - 255 Protein_49 hypothetical protein -
NZ657_RS24555 (40565) 40565..41737 + 1173 Protein_50 IS21 family transposase -
NZ657_RS24560 (41737) 41737..42534 + 798 WP_001554960.1 IS21-like element IS21 family helper ATPase IstB -
NZ657_RS24565 (42819) 42819..43043 + 225 WP_259583023.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NZ657_RS24570 (43040) 43040..43426 + 387 WP_000673985.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NZ657_RS24575 (44204) 44204..45928 - 1725 WP_001554923.1 ABC transporter ATP-binding protein -
NZ657_RS24580 (45928) 45928..46161 - 234 WP_235718725.1 lasso peptide biosynthesis B2 protein -
NZ657_RS24585 (46200) 46200..47168 + 969 WP_094321578.1 IS5 family transposase -
NZ657_RS24590 (47210) 47210..47677 - 468 WP_259583025.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) - 1..104244 104244
- inside IScluster/Tn - - 40565..47168 6603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(11-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14370.62 Da        Isoelectric Point: 7.0732

>T256954 WP_000673985.1 NZ_CP103975:43040-43426 [Escherichia coli]
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN

Download         Length: 387 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8409.48 Da        Isoelectric Point: 6.4565

>AT256954 WP_259583023.1 NZ_CP103975:42819-43043 [Escherichia coli]
MFTCNYSHARYNLASLLELAVDENQPVEIQRRKGGAAVLVDKDAFERYRKAALDAEFAEIMQSHGTAYTELSKR

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086V9Y9

Antitoxin

Source ID Structure

References