Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3673029..3673647 | Replicon | chromosome |
Accession | NZ_CP103974 | ||
Organism | Escherichia coli strain DLI.6n |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NZ657_RS17950 | Protein ID | WP_001291435.1 |
Coordinates | 3673429..3673647 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NZ657_RS17945 | Protein ID | WP_000344800.1 |
Coordinates | 3673029..3673403 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZ657_RS17935 (3668118) | 3668118..3669311 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NZ657_RS17940 (3669334) | 3669334..3672483 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NZ657_RS17945 (3673029) | 3673029..3673403 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NZ657_RS17950 (3673429) | 3673429..3673647 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NZ657_RS17955 (3673819) | 3673819..3674370 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NZ657_RS17960 (3674486) | 3674486..3674956 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NZ657_RS17965 (3675120) | 3675120..3676670 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NZ657_RS17970 (3676712) | 3676712..3677065 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NZ657_RS17980 (3677444) | 3677444..3677755 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NZ657_RS17985 (3677786) | 3677786..3678358 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256949 WP_001291435.1 NZ_CP103974:3673429-3673647 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256949 WP_000344800.1 NZ_CP103974:3673029-3673403 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |