Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2592191..2592829 | Replicon | chromosome |
| Accession | NZ_CP103974 | ||
| Organism | Escherichia coli strain DLI.6n | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NZ657_RS12550 | Protein ID | WP_000813794.1 |
| Coordinates | 2592653..2592829 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NZ657_RS12545 | Protein ID | WP_001270286.1 |
| Coordinates | 2592191..2592607 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZ657_RS12525 (2587345) | 2587345..2588286 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| NZ657_RS12530 (2588287) | 2588287..2589300 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NZ657_RS12535 (2589318) | 2589318..2590461 | - | 1144 | Protein_2456 | ABC transporter substrate-binding protein | - |
| NZ657_RS12540 (2590706) | 2590706..2592112 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| NZ657_RS12545 (2592191) | 2592191..2592607 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NZ657_RS12550 (2592653) | 2592653..2592829 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NZ657_RS12555 (2593051) | 2593051..2593281 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NZ657_RS12560 (2593373) | 2593373..2595334 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NZ657_RS12565 (2595407) | 2595407..2595943 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NZ657_RS12570 (2596035) | 2596035..2597210 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256948 WP_000813794.1 NZ_CP103974:c2592829-2592653 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256948 WP_001270286.1 NZ_CP103974:c2592607-2592191 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|