Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1972567..1973398 Replicon chromosome
Accession NZ_CP103974
Organism Escherichia coli strain DLI.6n

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NZ657_RS09500 Protein ID WP_000854814.1
Coordinates 1972567..1972941 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag NZ657_RS09505 Protein ID WP_001285584.1
Coordinates 1973030..1973398 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZ657_RS09460 (1967963) 1967963..1969129 + 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NZ657_RS09465 (1969248) 1969248..1969721 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
NZ657_RS09470 (1969919) 1969919..1970977 + 1059 WP_001200891.1 FUSC family protein -
NZ657_RS09475 (1971149) 1971149..1971478 + 330 WP_000450409.1 DUF496 family protein -
NZ657_RS09480 (1971579) 1971579..1971902 - 324 WP_225343796.1 EutP/PduV family microcompartment system protein -
NZ657_RS09485 (1971881) 1971881..1971961 + 81 WP_023441679.1 hypothetical protein -
NZ657_RS09490 (1972250) 1972250..1972330 - 81 Protein_1858 hypothetical protein -
NZ657_RS09495 (1972376) 1972376..1972570 - 195 WP_000988600.1 DUF5983 family protein -
NZ657_RS09500 (1972567) 1972567..1972941 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NZ657_RS09505 (1973030) 1973030..1973398 - 369 WP_001285584.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NZ657_RS09510 (1973472) 1973472..1973693 - 222 WP_000692323.1 DUF987 domain-containing protein -
NZ657_RS09515 (1973756) 1973756..1974232 - 477 WP_077487613.1 RadC family protein -
NZ657_RS09520 (1974248) 1974248..1974727 - 480 WP_000860076.1 antirestriction protein -
NZ657_RS09525 (1974809) 1974809..1975627 - 819 WP_001234629.1 DUF932 domain-containing protein -
NZ657_RS09530 (1975727) 1975727..1975960 - 234 WP_001119729.1 DUF905 family protein -
NZ657_RS09535 (1976039) 1976039..1976494 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T256942 WP_000854814.1 NZ_CP103974:c1972941-1972567 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT256942 WP_001285584.1 NZ_CP103974:c1973398-1973030 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References