Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1972567..1973398 | Replicon | chromosome |
| Accession | NZ_CP103974 | ||
| Organism | Escherichia coli strain DLI.6n | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NZ657_RS09500 | Protein ID | WP_000854814.1 |
| Coordinates | 1972567..1972941 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NZ657_RS09505 | Protein ID | WP_001285584.1 |
| Coordinates | 1973030..1973398 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZ657_RS09460 (1967963) | 1967963..1969129 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NZ657_RS09465 (1969248) | 1969248..1969721 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NZ657_RS09470 (1969919) | 1969919..1970977 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NZ657_RS09475 (1971149) | 1971149..1971478 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NZ657_RS09480 (1971579) | 1971579..1971902 | - | 324 | WP_225343796.1 | EutP/PduV family microcompartment system protein | - |
| NZ657_RS09485 (1971881) | 1971881..1971961 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| NZ657_RS09490 (1972250) | 1972250..1972330 | - | 81 | Protein_1858 | hypothetical protein | - |
| NZ657_RS09495 (1972376) | 1972376..1972570 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NZ657_RS09500 (1972567) | 1972567..1972941 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NZ657_RS09505 (1973030) | 1973030..1973398 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NZ657_RS09510 (1973472) | 1973472..1973693 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NZ657_RS09515 (1973756) | 1973756..1974232 | - | 477 | WP_077487613.1 | RadC family protein | - |
| NZ657_RS09520 (1974248) | 1974248..1974727 | - | 480 | WP_000860076.1 | antirestriction protein | - |
| NZ657_RS09525 (1974809) | 1974809..1975627 | - | 819 | WP_001234629.1 | DUF932 domain-containing protein | - |
| NZ657_RS09530 (1975727) | 1975727..1975960 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NZ657_RS09535 (1976039) | 1976039..1976494 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T256942 WP_000854814.1 NZ_CP103974:c1972941-1972567 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT256942 WP_001285584.1 NZ_CP103974:c1973398-1973030 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |