Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 939058..939712 | Replicon | chromosome |
Accession | NZ_CP103974 | ||
Organism | Escherichia coli strain DLI.6n |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NZ657_RS04575 | Protein ID | WP_000244777.1 |
Coordinates | 939305..939712 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NZ657_RS04570 | Protein ID | WP_000354046.1 |
Coordinates | 939058..939324 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZ657_RS04545 (934227) | 934227..934970 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
NZ657_RS04550 (935027) | 935027..936460 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
NZ657_RS04555 (936505) | 936505..936816 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
NZ657_RS04560 (936980) | 936980..937639 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NZ657_RS04565 (937835) | 937835..938815 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NZ657_RS04570 (939058) | 939058..939324 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NZ657_RS04575 (939305) | 939305..939712 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
NZ657_RS04580 (939752) | 939752..940273 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NZ657_RS04585 (940385) | 940385..941281 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NZ657_RS04590 (941306) | 941306..942016 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NZ657_RS04595 (942022) | 942022..943755 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T256938 WP_000244777.1 NZ_CP103974:939305-939712 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |