Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4057450..4058068 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NZD79_RS19805 | Protein ID | WP_001291435.1 |
| Coordinates | 4057450..4057668 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NZD79_RS19810 | Protein ID | WP_000344800.1 |
| Coordinates | 4057694..4058068 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS19770 (4052739) | 4052739..4053311 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| NZD79_RS19775 (4053342) | 4053342..4053653 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| NZD79_RS19785 (4054032) | 4054032..4054385 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NZD79_RS19790 (4054427) | 4054427..4055977 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NZD79_RS19795 (4056141) | 4056141..4056611 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NZD79_RS19800 (4056727) | 4056727..4057278 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NZD79_RS19805 (4057450) | 4057450..4057668 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NZD79_RS19810 (4057694) | 4057694..4058068 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NZD79_RS19815 (4058614) | 4058614..4061763 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NZD79_RS19820 (4061786) | 4061786..4062979 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256934 WP_001291435.1 NZ_CP103972:c4057668-4057450 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256934 WP_000344800.1 NZ_CP103972:c4058068-4057694 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |