Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1958809..1959610 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D3GU15 |
| Locus tag | NZD79_RS09560 | Protein ID | WP_001094429.1 |
| Coordinates | 1959233..1959610 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D3GU16 |
| Locus tag | NZD79_RS09555 | Protein ID | WP_001285617.1 |
| Coordinates | 1958809..1959186 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS09520 (1953995) | 1953995..1954867 | + | 873 | WP_001069724.1 | GTPase family protein | - |
| NZD79_RS09525 (1955195) | 1955195..1955980 | + | 786 | Protein_1867 | autotransporter adhesin family protein | - |
| NZD79_RS09530 (1956027) | 1956027..1956236 | + | 210 | WP_259568224.1 | DUF905 family protein | - |
| NZD79_RS09535 (1956336) | 1956336..1957154 | + | 819 | WP_001234625.1 | DUF932 domain-containing protein | - |
| NZD79_RS09540 (1957456) | 1957456..1957929 | + | 474 | WP_000855081.1 | antirestriction protein | - |
| NZD79_RS09545 (1957945) | 1957945..1958421 | + | 477 | WP_001388380.1 | RadC family protein | - |
| NZD79_RS09550 (1958508) | 1958508..1958729 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| NZD79_RS09555 (1958809) | 1958809..1959186 | + | 378 | WP_001285617.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NZD79_RS09560 (1959233) | 1959233..1959610 | + | 378 | WP_001094429.1 | TA system toxin CbtA family protein | Toxin |
| NZD79_RS09565 (1959607) | 1959607..1959804 | + | 198 | Protein_1875 | DUF5983 family protein | - |
| NZD79_RS09570 (1959832) | 1959832..1960029 | + | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| NZD79_RS09575 (1960114) | 1960114..1960956 | + | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| NZD79_RS09580 (1961237) | 1961237..1961773 | - | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| NZD79_RS09585 (1961775) | 1961775..1962925 | - | 1151 | Protein_1879 | inorganic phosphate transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13856.73 Da Isoelectric Point: 6.8601
>T256927 WP_001094429.1 NZ_CP103972:1959233-1959610 [Escherichia coli]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13715.59 Da Isoelectric Point: 6.6240
>AT256927 WP_001285617.1 NZ_CP103972:1958809-1959186 [Escherichia coli]
VSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVU5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D3GU16 |