Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1803553..1804169 Replicon chromosome
Accession NZ_CP103965
Organism Pseudomonas sp. N3-W

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NYP20_RS08270 Protein ID WP_259500819.1
Coordinates 1803553..1803765 (+) Length 71 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NYP20_RS08275 Protein ID WP_259500821.1
Coordinates 1803765..1804169 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP20_RS08235 (NYP20_08235) 1798859..1799395 + 537 WP_259500807.1 DsbE family thiol:disulfide interchange protein -
NYP20_RS08240 (NYP20_08240) 1799392..1799862 + 471 WP_259500809.1 cytochrome c-type biogenesis protein CcmH -
NYP20_RS08245 (NYP20_08245) 1799859..1801061 + 1203 WP_259500811.1 c-type cytochrome biogenesis protein CcmI -
NYP20_RS08250 (NYP20_08250) 1801076..1801483 + 408 WP_259500813.1 hypothetical protein -
NYP20_RS08255 (NYP20_08255) 1801642..1802217 + 576 WP_259500815.1 phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN -
NYP20_RS08260 (NYP20_08260) 1802225..1802800 - 576 WP_259500818.1 PIN domain-containing protein -
NYP20_RS08265 (NYP20_08265) 1802797..1803264 - 468 WP_259503120.1 helix-turn-helix domain-containing protein -
NYP20_RS08270 (NYP20_08270) 1803553..1803765 + 213 WP_259500819.1 type II toxin-antitoxin system HicA family toxin Toxin
NYP20_RS08275 (NYP20_08275) 1803765..1804169 + 405 WP_259500821.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NYP20_RS08280 (NYP20_08280) 1804244..1805452 - 1209 WP_259500823.1 MFS transporter -
NYP20_RS08285 (NYP20_08285) 1805690..1806307 + 618 WP_259500825.1 DUF5666 domain-containing protein -
NYP20_RS08290 (NYP20_08290) 1806543..1807541 - 999 WP_259500827.1 sulfate ABC transporter substrate-binding protein -
NYP20_RS08295 (NYP20_08295) 1807695..1808519 - 825 WP_259500828.1 ion transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(7-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 71 a.a.        Molecular weight: 7976.24 Da        Isoelectric Point: 10.1896

>T256914 WP_259500819.1 NZ_CP103965:1803553-1803765 [Pseudomonas sp. N3-W]
VQSRLLMKELMEAGWTLDRVTGSHHIFTHRYNPYTIPVPHPKKDLPFGTVKSIRRRAGLYCPPASYAGDP

Download         Length: 213 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14767.79 Da        Isoelectric Point: 4.4875

>AT256914 WP_259500821.1 NZ_CP103965:1803765-1804169 [Pseudomonas sp. N3-W]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEMAAGGESIPMPTSAATHRGNPEFAEMGWGM
LELDISPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References