Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 352941..353578 | Replicon | chromosome |
Accession | NZ_CP103965 | ||
Organism | Pseudomonas sp. N3-W |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYP20_RS01610 | Protein ID | WP_259498367.1 |
Coordinates | 352941..353348 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYP20_RS01615 | Protein ID | WP_259498368.1 |
Coordinates | 353348..353578 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP20_RS01590 (NYP20_01590) | 348615..349310 | - | 696 | WP_259498360.1 | ABC transporter permease | - |
NYP20_RS01595 (NYP20_01595) | 349389..350138 | - | 750 | WP_259498362.1 | ABC transporter substrate-binding protein | - |
NYP20_RS01600 (NYP20_01600) | 350152..350925 | - | 774 | WP_259498364.1 | ABC transporter ATP-binding protein | - |
NYP20_RS01605 (NYP20_01605) | 351476..352867 | + | 1392 | WP_259498366.1 | GABA permease | - |
NYP20_RS01610 (NYP20_01610) | 352941..353348 | - | 408 | WP_259498367.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NYP20_RS01615 (NYP20_01615) | 353348..353578 | - | 231 | WP_259498368.1 | antitoxin | Antitoxin |
NYP20_RS01620 (NYP20_01620) | 353749..354213 | - | 465 | WP_259498370.1 | hypothetical protein | - |
NYP20_RS01625 (NYP20_01625) | 354220..354633 | - | 414 | WP_259498372.1 | hypothetical protein | - |
NYP20_RS01630 (NYP20_01630) | 354671..355639 | - | 969 | WP_259498374.1 | alpha/beta fold hydrolase | - |
NYP20_RS01635 (NYP20_01635) | 355980..356429 | + | 450 | WP_259498376.1 | carboxypeptidase regulatory-like domain-containing protein | - |
NYP20_RS01645 (NYP20_01645) | 356840..357112 | - | 273 | WP_010464608.1 | oxidative damage protection protein | - |
NYP20_RS01650 (NYP20_01650) | 357109..358176 | - | 1068 | WP_259498382.1 | A/G-specific adenine glycosylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15130.45 Da Isoelectric Point: 6.8631
>T256912 WP_259498367.1 NZ_CP103965:c353348-352941 [Pseudomonas sp. N3-W]
MIKFMLDTNICIFTIKNKPQVVREAFNRHHSQLCISTITLMELIYGAEKSAAPEKNLSIVESFAARLEILPFDSDAAAHT
GMIRSELAKAGTPIGPYDQMIAGHARSRGFTVVTNNLREFERVPGLRVEDWVQPE
MIKFMLDTNICIFTIKNKPQVVREAFNRHHSQLCISTITLMELIYGAEKSAAPEKNLSIVESFAARLEILPFDSDAAAHT
GMIRSELAKAGTPIGPYDQMIAGHARSRGFTVVTNNLREFERVPGLRVEDWVQPE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|