Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 272028..272671 | Replicon | chromosome |
Accession | NZ_CP103965 | ||
Organism | Pseudomonas sp. N3-W |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NYP20_RS01205 | Protein ID | WP_259498221.1 |
Coordinates | 272028..272210 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NYP20_RS01210 | Protein ID | WP_259503073.1 |
Coordinates | 272270..272671 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP20_RS01190 (NYP20_01190) | 267982..268908 | + | 927 | WP_259498217.1 | serine acetyltransferase | - |
NYP20_RS01195 (NYP20_01195) | 269318..271279 | + | 1962 | WP_259503072.1 | choline transporter BetT | - |
NYP20_RS01200 (NYP20_01200) | 271294..271551 | - | 258 | WP_259498219.1 | hypothetical protein | - |
NYP20_RS01205 (NYP20_01205) | 272028..272210 | + | 183 | WP_259498221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NYP20_RS01210 (NYP20_01210) | 272270..272671 | + | 402 | WP_259503073.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NYP20_RS01215 (NYP20_01215) | 272813..273853 | - | 1041 | WP_259498223.1 | LacI family DNA-binding transcriptional regulator | - |
NYP20_RS01220 (NYP20_01220) | 274060..276285 | + | 2226 | WP_259498225.1 | TonB-dependent receptor | - |
NYP20_RS01225 (NYP20_01225) | 276288..277607 | + | 1320 | WP_259498227.1 | LLM class flavin-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6785.87 Da Isoelectric Point: 10.7495
>T256911 WP_259498221.1 NZ_CP103965:272028-272210 [Pseudomonas sp. N3-W]
MRSREMIRMIEHDGSYLVAVKGSHHQYKHSFKSGRVTIKHPDSDLPKGTINGILKQAGLK
MRSREMIRMIEHDGSYLVAVKGSHHQYKHSFKSGRVTIKHPDSDLPKGTINGILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14541.31 Da Isoelectric Point: 4.3752
>AT256911 WP_259503073.1 NZ_CP103965:272270-272671 [Pseudomonas sp. N3-W]
MKFPVVLHKDADSEYGVIIPDVPGCFSAGATVSQAFESVKEALALHYEGLVADGDPLPQVQEIDAHLDNPDYAGGVWGVV
EFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
MKFPVVLHKDADSEYGVIIPDVPGCFSAGATVSQAFESVKEALALHYEGLVADGDPLPQVQEIDAHLDNPDYAGGVWGVV
EFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|