Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 2211391..2212499 | Replicon | chromosome |
| Accession | NZ_CP103964 | ||
| Organism | Staphylococcus hyicus strain MM2101 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | NZD48_RS10830 | Protein ID | WP_000233000.1 |
| Coordinates | 2211391..2212260 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | NZD48_RS10835 | Protein ID | WP_000205227.1 |
| Coordinates | 2212275..2212499 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD48_RS10810 (NZD48_10810) | 2207662..2208981 | - | 1320 | WP_259489111.1 | IS1380-like element ISSsu5 family transposase | - |
| NZD48_RS10815 (NZD48_10815) | 2209209..2209736 | - | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
| NZD48_RS10820 (NZD48_10820) | 2209780..2210643 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| NZD48_RS10825 (NZD48_10825) | 2210676..2211410 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| NZD48_RS10830 (NZD48_10830) | 2211391..2212260 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| NZD48_RS10835 (NZD48_10835) | 2212275..2212499 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NZD48_RS10840 (NZD48_10840) | 2212642..2214186 | - | 1545 | WP_002390960.1 | recombinase family protein | - |
| NZD48_RS10845 (NZD48_10845) | 2214206..2214622 | - | 417 | WP_000323438.1 | recombinase | - |
| NZD48_RS10850 (NZD48_10850) | 2214623..2215120 | - | 498 | WP_002327635.1 | DNA recombinase | - |
| NZD48_RS10855 (NZD48_10855) | 2215396..2216715 | + | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaZ / erm(B) / ant(6)-Ia | - | 2190145..2216715 | 26570 | |
| - | inside | IScluster/Tn | erm(B) / ant(6)-Ia | - | 2204716..2216715 | 11999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T256910 WP_000233000.1 NZ_CP103964:c2212260-2211391 [Staphylococcus hyicus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|