Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 2201882..2203019 | Replicon | chromosome |
Accession | NZ_CP103964 | ||
Organism | Staphylococcus hyicus strain MM2101 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | D1MAU9 |
Locus tag | NZD48_RS10765 | Protein ID | WP_002333464.1 |
Coordinates | 2201882..2202745 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | NZD48_RS10770 | Protein ID | WP_000301765.1 |
Coordinates | 2202747..2203019 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZD48_RS10740 (NZD48_10740) | 2196895..2197740 | - | 846 | WP_000733283.1 | BlaZ family penicillin-hydrolyzing class A beta-lactamase PC1 | - |
NZD48_RS10745 (NZD48_10745) | 2197847..2199604 | + | 1758 | WP_001096374.1 | beta-lactam sensor/signal transducer BlaR1 | - |
NZD48_RS10750 (NZD48_10750) | 2199594..2199974 | + | 381 | WP_001284656.1 | penicillinase repressor BlaI | - |
NZD48_RS10755 (NZD48_10755) | 2200238..2200831 | + | 594 | WP_000690636.1 | recombinase family protein | - |
NZD48_RS10760 (NZD48_10760) | 2201070..2201441 | - | 372 | WP_259489101.1 | hypothetical protein | - |
NZD48_RS10765 (NZD48_10765) | 2201882..2202745 | - | 864 | WP_002333464.1 | zeta toxin family protein | Toxin |
NZD48_RS10770 (NZD48_10770) | 2202747..2203019 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
NZD48_RS10775 (NZD48_10775) | 2203036..2203251 | - | 216 | WP_002321610.1 | peptide-binding protein | - |
NZD48_RS10780 (NZD48_10780) | 2203322..2204218 | - | 897 | WP_001809760.1 | ParA family protein | - |
NZD48_RS10785 (NZD48_10785) | 2204286..2204546 | - | 261 | Protein_2096 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
NZD48_RS10790 (NZD48_10790) | 2204716..2205453 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
NZD48_RS10795 (NZD48_10795) | 2205578..2205673 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
NZD48_RS10800 (NZD48_10800) | 2205742..2205864 | - | 123 | Protein_2099 | peptide-binding protein | - |
NZD48_RS10805 (NZD48_10805) | 2205984..2207510 | - | 1527 | WP_259489110.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | blaZ / erm(B) / ant(6)-Ia | - | 2190145..2216715 | 26570 | |
- | inside | IScluster/Tn | erm(B) / ant(6)-Ia | - | 2204716..2216715 | 11999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32370.87 Da Isoelectric Point: 6.6610
>T256909 WP_002333464.1 NZ_CP103964:c2202745-2201882 [Staphylococcus hyicus]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D1MAU9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F0A3 |