Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 1721604..1722392 | Replicon | chromosome |
Accession | NZ_CP103964 | ||
Organism | Staphylococcus hyicus strain MM2101 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NZD48_RS08355 | Protein ID | WP_259488809.1 |
Coordinates | 1721937..1722392 (+) | Length | 152 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NZD48_RS08350 | Protein ID | WP_259488808.1 |
Coordinates | 1721604..1721924 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZD48_RS08300 (NZD48_08300) | 1716822..1717361 | - | 540 | WP_259488799.1 | hypothetical protein | - |
NZD48_RS08305 (NZD48_08305) | 1717368..1718705 | - | 1338 | WP_259488800.1 | DEAD/DEAH box helicase | - |
NZD48_RS08310 (NZD48_08310) | 1718689..1719399 | - | 711 | WP_259488801.1 | AAA family ATPase | - |
NZD48_RS08315 (NZD48_08315) | 1719399..1719884 | - | 486 | WP_259488802.1 | siphovirus Gp157 family protein | - |
NZD48_RS08320 (NZD48_08320) | 1719877..1720053 | - | 177 | WP_259488803.1 | hypothetical protein | - |
NZD48_RS08325 (NZD48_08325) | 1720131..1720298 | - | 168 | WP_259488804.1 | hypothetical protein | - |
NZD48_RS08330 (NZD48_08330) | 1720292..1720504 | - | 213 | WP_107396783.1 | hypothetical protein | - |
NZD48_RS08335 (NZD48_08335) | 1720602..1720880 | + | 279 | WP_259488806.1 | hypothetical protein | - |
NZD48_RS08340 (NZD48_08340) | 1720861..1721025 | - | 165 | WP_259488807.1 | hypothetical protein | - |
NZD48_RS08345 (NZD48_08345) | 1721185..1721382 | - | 198 | WP_105967178.1 | helix-turn-helix transcriptional regulator | - |
NZD48_RS08350 (NZD48_08350) | 1721604..1721924 | + | 321 | WP_259488808.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NZD48_RS08355 (NZD48_08355) | 1721937..1722392 | + | 456 | WP_259488809.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
NZD48_RS08360 (NZD48_08360) | 1722450..1722745 | + | 296 | Protein_1614 | TM2 domain-containing protein | - |
NZD48_RS08365 (NZD48_08365) | 1722901..1723383 | + | 483 | WP_065520445.1 | hypothetical protein | - |
NZD48_RS08370 (NZD48_08370) | 1723383..1723727 | + | 345 | WP_065520444.1 | DUF3969 family protein | - |
NZD48_RS08375 (NZD48_08375) | 1724061..1724534 | + | 474 | WP_257052661.1 | hypothetical protein | - |
NZD48_RS08380 (NZD48_08380) | 1724539..1725330 | + | 792 | WP_257052660.1 | DUF1828 domain-containing protein | - |
NZD48_RS08385 (NZD48_08385) | 1725386..1726411 | + | 1026 | WP_259488812.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1686922..1746080 | 59158 | |
- | inside | Prophage | - | - | 1686922..1780453 | 93531 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 152 a.a. Molecular weight: 17698.30 Da Isoelectric Point: 7.4546
>T256908 WP_259488809.1 NZ_CP103964:1721937-1722392 [Staphylococcus hyicus]
MAKYEDLMIQNSHIPISDEYSLKRNFKGIYANGVILIDKNLSNAEKHEVLSEELAHHKLTYGNILDQSNMLNRKFELKAR
RLANESVITLQGLINAFNYGVQNIYDLATYFEVTKDFVLDAIQHYKQKYGLRTRYGKYIIEFEPLIIYKDL
MAKYEDLMIQNSHIPISDEYSLKRNFKGIYANGVILIDKNLSNAEKHEVLSEELAHHKLTYGNILDQSNMLNRKFELKAR
RLANESVITLQGLINAFNYGVQNIYDLATYFEVTKDFVLDAIQHYKQKYGLRTRYGKYIIEFEPLIIYKDL
Download Length: 456 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|