Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1006027..1006800 | Replicon | chromosome |
Accession | NZ_CP103964 | ||
Organism | Staphylococcus hyicus strain MM2101 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | NZD48_RS04880 | Protein ID | WP_167693803.1 |
Coordinates | 1006645..1006800 (+) | Length | 52 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A0A8HNH4 |
Locus tag | NZD48_RS04875 | Protein ID | WP_039644857.1 |
Coordinates | 1006027..1006626 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZD48_RS04855 (NZD48_04855) | 1002337..1003059 | + | 723 | WP_039644852.1 | amino acid ABC transporter ATP-binding protein | - |
NZD48_RS04860 (NZD48_04860) | 1003224..1004351 | + | 1128 | WP_252547564.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NZD48_RS04865 (NZD48_04865) | 1004354..1004824 | + | 471 | WP_039644854.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NZD48_RS04870 (NZD48_04870) | 1004840..1006009 | + | 1170 | WP_259490305.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
NZD48_RS04875 (NZD48_04875) | 1006027..1006626 | + | 600 | WP_039644857.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NZD48_RS04880 (NZD48_04880) | 1006645..1006800 | + | 156 | WP_167693803.1 | SAS053 family protein | Toxin |
NZD48_RS04885 (NZD48_04885) | 1006956..1007360 | + | 405 | WP_039644859.1 | hypothetical protein | - |
NZD48_RS04890 (NZD48_04890) | 1007518..1008903 | + | 1386 | WP_259490309.1 | class II fumarate hydratase | - |
NZD48_RS04895 (NZD48_04895) | 1008925..1010451 | + | 1527 | WP_259490310.1 | exopolyphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5989.31 Da Isoelectric Point: 3.9940
>T256907 WP_167693803.1 NZ_CP103964:1006645-1006800 [Staphylococcus hyicus]
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
Download Length: 156 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22363.41 Da Isoelectric Point: 6.0248
>AT256907 WP_039644857.1 NZ_CP103964:1006027-1006626 [Staphylococcus hyicus]
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|