Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 866829..867353 | Replicon | chromosome |
Accession | NZ_CP103964 | ||
Organism | Staphylococcus hyicus strain MM2101 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0A8HRS0 |
Locus tag | NZD48_RS04075 | Protein ID | WP_037567539.1 |
Coordinates | 867000..867353 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A0A8HN67 |
Locus tag | NZD48_RS04070 | Protein ID | WP_039644674.1 |
Coordinates | 866829..866999 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZD48_RS04045 (NZD48_04045) | 862624..863100 | + | 477 | WP_252538113.1 | PH domain-containing protein | - |
NZD48_RS04050 (NZD48_04050) | 863093..864583 | + | 1491 | WP_259490166.1 | PH domain-containing protein | - |
NZD48_RS04055 (NZD48_04055) | 864564..865079 | + | 516 | WP_259490167.1 | PH domain-containing protein | - |
NZD48_RS04060 (NZD48_04060) | 865147..865497 | + | 351 | WP_259490169.1 | holo-ACP synthase | - |
NZD48_RS04065 (NZD48_04065) | 865597..866745 | + | 1149 | WP_259490171.1 | alanine racemase | - |
NZD48_RS04070 (NZD48_04070) | 866829..866999 | + | 171 | WP_039644674.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NZD48_RS04075 (NZD48_04075) | 867000..867353 | + | 354 | WP_037567539.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NZD48_RS04080 (NZD48_04080) | 867430..868416 | + | 987 | WP_241961404.1 | PP2C family protein-serine/threonine phosphatase | - |
NZD48_RS04085 (NZD48_04085) | 868497..868823 | + | 327 | WP_039644676.1 | anti-sigma factor antagonist | - |
NZD48_RS04090 (NZD48_04090) | 868826..869305 | + | 480 | WP_039644678.1 | anti-sigma B factor RsbW | - |
NZD48_RS04095 (NZD48_04095) | 869280..870050 | + | 771 | WP_107633600.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13103.33 Da Isoelectric Point: 10.3729
>T256906 WP_037567539.1 NZ_CP103964:867000-867353 [Staphylococcus hyicus]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8HRS0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8HN67 |