Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 377144..378174 | Replicon | chromosome |
Accession | NZ_CP103903 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 6211/17 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY027_RS01765 | Protein ID | WP_259596860.1 |
Coordinates | 377144..377563 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY027_RS01770 | Protein ID | WP_010934564.1 |
Coordinates | 377608..378174 (-) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY027_RS01750 (NY027_01750) | 373801..374655 | + | 855 | WP_010934561.1 | hypothetical protein | - |
NY027_RS01755 (NY027_01755) | 374648..375556 | - | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY027_RS01760 (NY027_01760) | 375685..376884 | - | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY027_RS01765 (NY027_01765) | 377144..377563 | - | 420 | WP_259596860.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY027_RS01770 (NY027_01770) | 377608..378174 | - | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY027_RS01775 (NY027_01775) | 378495..378767 | - | 273 | WP_010934566.1 | hypothetical protein | - |
NY027_RS01780 (NY027_01780) | 379927..380367 | - | 441 | WP_014301588.1 | hypothetical protein | - |
NY027_RS01785 (NY027_01785) | 380455..380727 | + | 273 | WP_226813719.1 | hypothetical protein | - |
NY027_RS01790 (NY027_01790) | 380750..381172 | - | 423 | WP_241800074.1 | DUF4065 domain-containing protein | - |
NY027_RS01795 (NY027_01795) | 381462..381785 | - | 324 | WP_010934571.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 377144..396707 | 19563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15564.73 Da Isoelectric Point: 8.7021
>T256902 WP_259596860.1 NZ_CP103903:c377563-377144 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGSIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGSIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256902 WP_010934564.1 NZ_CP103903:c378174-377608 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|