Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-pasA/RelE-HTH
Location 995163..995646 Replicon chromosome
Accession NZ_CP103902
Organism Corynebacterium diphtheriae bv. mitis strain 6272/17

Toxin (Protein)


Gene name relE Uniprot ID A0A1X4MAI5
Locus tag NY028_RS04955 Protein ID WP_003850119.1
Coordinates 995163..995426 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag NY028_RS04960 Protein ID WP_003850117.1
Coordinates 995410..995646 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NY028_RS04930 (NY028_04930) 991913..992539 - 627 WP_003850128.1 hypothetical protein -
NY028_RS04935 (NY028_04935) 992679..993599 + 921 WP_021335362.1 alpha/beta hydrolase -
NY028_RS04940 (NY028_04940) 993609..993914 - 306 WP_003850125.1 MGMT family protein -
NY028_RS04945 (NY028_04945) 993920..994744 - 825 WP_014301205.1 VOC family protein -
NY028_RS04950 (NY028_04950) 994744..995037 - 294 WP_014302727.1 RNA-binding S4 domain-containing protein -
NY028_RS04955 (NY028_04955) 995163..995426 - 264 WP_003850119.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NY028_RS04960 (NY028_04960) 995410..995646 - 237 WP_003850117.1 ribbon-helix-helix domain-containing protein Antitoxin
NY028_RS04965 (NY028_04965) 996149..996832 + 684 WP_196970670.1 hypothetical protein -
NY028_RS04970 (NY028_04970) 997044..997796 - 753 WP_244659961.1 IS30 family transposase -
NY028_RS04975 (NY028_04975) 997718..998629 - 912 WP_244659962.1 helix-turn-helix domain-containing protein -
NY028_RS04980 (NY028_04980) 998847..999605 - 759 WP_196970671.1 hypothetical protein -
NY028_RS04985 (NY028_04985) 999714..999908 - 195 WP_259516724.1 hypothetical protein -
NY028_RS04990 (NY028_04990) 999871..1000134 - 264 WP_259516798.1 LysE family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 987420..1021082 33662


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

Predicted DNA-binding protein, ribbon-helix-helix domain

(7-43)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 9939.50 Da        Isoelectric Point: 10.9201

>T256901 WP_003850119.1 NZ_CP103902:c995426-995163 [Corynebacterium diphtheriae bv. mitis]
VAWEISFSPRAVKSFKKLDTGEQRRVSKFLREVGALEDPRLRGKALTANKSGLWRWRVGDYRIIADIVDARVVVVVVDVG
HRSKVYD

Download         Length: 264 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8911.02 Da        Isoelectric Point: 4.8604

>AT256901 WP_003850117.1 NZ_CP103902:c995646-995410 [Corynebacterium diphtheriae bv. mitis]
MSGSVISLRIDDEQKRRLDELSRRTGRPCSFYLREALSAHLADLEYVYRLEEEAAQVRRGELGTVPLSQLERECGLGD

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X4MAI5

Antitoxin

Source ID Structure

References