Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 2400176..2401206 | Replicon | chromosome |
Accession | NZ_CP103900 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 7072/17 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY030_RS11285 | Protein ID | WP_199323424.1 |
Coordinates | 2400787..2401206 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY030_RS11280 | Protein ID | WP_010934564.1 |
Coordinates | 2400176..2400742 (+) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY030_RS11255 (NY030_11255) | 2396567..2396890 | + | 324 | WP_010934571.1 | hypothetical protein | - |
NY030_RS11260 (NY030_11260) | 2397282..2397650 | + | 369 | WP_244658603.1 | hypothetical protein | - |
NY030_RS11265 (NY030_11265) | 2397623..2397895 | - | 273 | WP_226813719.1 | hypothetical protein | - |
NY030_RS11270 (NY030_11270) | 2397983..2398423 | + | 441 | WP_014301588.1 | hypothetical protein | - |
NY030_RS11275 (NY030_11275) | 2399583..2399855 | + | 273 | WP_010934566.1 | hypothetical protein | - |
NY030_RS11280 (NY030_11280) | 2400176..2400742 | + | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY030_RS11285 (NY030_11285) | 2400787..2401206 | + | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY030_RS11290 (NY030_11290) | 2401466..2402665 | + | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY030_RS11295 (NY030_11295) | 2402794..2403702 | + | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY030_RS11300 (NY030_11300) | 2403695..2404549 | - | 855 | WP_010934561.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2382427..2402665 | 20238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256898 WP_199323424.1 NZ_CP103900:2400787-2401206 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256898 WP_010934564.1 NZ_CP103900:2400176-2400742 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|