Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 377116..378146 | Replicon | chromosome |
Accession | NZ_CP103899 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 453/18 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY031_RS01765 | Protein ID | WP_199323424.1 |
Coordinates | 377116..377535 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY031_RS01770 | Protein ID | WP_010934564.1 |
Coordinates | 377580..378146 (-) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY031_RS01750 (NY031_01750) | 373774..374628 | + | 855 | WP_010934561.1 | hypothetical protein | - |
NY031_RS01755 (NY031_01755) | 374621..375529 | - | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY031_RS01760 (NY031_01760) | 375658..376857 | - | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY031_RS01765 (NY031_01765) | 377116..377535 | - | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY031_RS01770 (NY031_01770) | 377580..378146 | - | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY031_RS01775 (NY031_01775) | 378467..378739 | - | 273 | WP_010934566.1 | hypothetical protein | - |
NY031_RS01780 (NY031_01780) | 379899..380339 | - | 441 | WP_014301588.1 | hypothetical protein | - |
NY031_RS01785 (NY031_01785) | 380427..380699 | + | 273 | WP_226813719.1 | hypothetical protein | - |
NY031_RS01790 (NY031_01790) | 380672..381040 | - | 369 | WP_244658603.1 | hypothetical protein | - |
NY031_RS01795 (NY031_01795) | 381432..381755 | - | 324 | WP_010934571.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 377116..396676 | 19560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256897 WP_199323424.1 NZ_CP103899:c377535-377116 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256897 WP_010934564.1 NZ_CP103899:c378146-377580 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|