Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 2387338..2388368 | Replicon | chromosome |
Accession | NZ_CP103897 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 2736/18 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY033_RS11140 | Protein ID | WP_199323424.1 |
Coordinates | 2387949..2388368 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY033_RS11135 | Protein ID | WP_010934564.1 |
Coordinates | 2387338..2387904 (+) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY033_RS11110 (NY033_11110) | 2383727..2384050 | + | 324 | WP_010934571.1 | hypothetical protein | - |
NY033_RS11115 (NY033_11115) | 2384319..2384762 | + | 444 | WP_259564882.1 | DUF4065 domain-containing protein | - |
NY033_RS11120 (NY033_11120) | 2384785..2385057 | - | 273 | WP_226813719.1 | hypothetical protein | - |
NY033_RS11125 (NY033_11125) | 2385145..2385585 | + | 441 | WP_014301588.1 | hypothetical protein | - |
NY033_RS11130 (NY033_11130) | 2386745..2387017 | + | 273 | WP_010934566.1 | hypothetical protein | - |
NY033_RS11135 (NY033_11135) | 2387338..2387904 | + | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY033_RS11140 (NY033_11140) | 2387949..2388368 | + | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY033_RS11145 (NY033_11145) | 2388628..2389827 | + | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY033_RS11150 (NY033_11150) | 2389956..2390864 | + | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY033_RS11155 (NY033_11155) | 2390857..2391711 | - | 855 | WP_010934561.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2368805..2389827 | 21022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256895 WP_199323424.1 NZ_CP103897:2387949-2388368 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256895 WP_010934564.1 NZ_CP103897:2387338-2387904 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|