Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 995177..995660 | Replicon | chromosome |
Accession | NZ_CP103894 | ||
Organism | Corynebacterium diphtheriae bv. mitis strain 632/19 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1X4MAI5 |
Locus tag | NY036_RS04950 | Protein ID | WP_003850119.1 |
Coordinates | 995177..995440 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | NY036_RS04955 | Protein ID | WP_003850117.1 |
Coordinates | 995424..995660 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY036_RS04925 (NY036_04925) | 991927..992553 | - | 627 | WP_003850128.1 | hypothetical protein | - |
NY036_RS04930 (NY036_04930) | 992693..993613 | + | 921 | WP_021335362.1 | alpha/beta hydrolase | - |
NY036_RS04935 (NY036_04935) | 993623..993928 | - | 306 | WP_003850125.1 | MGMT family protein | - |
NY036_RS04940 (NY036_04940) | 993934..994758 | - | 825 | WP_014301205.1 | VOC family protein | - |
NY036_RS04945 (NY036_04945) | 994758..995051 | - | 294 | WP_014302727.1 | RNA-binding S4 domain-containing protein | - |
NY036_RS04950 (NY036_04950) | 995177..995440 | - | 264 | WP_003850119.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NY036_RS04955 (NY036_04955) | 995424..995660 | - | 237 | WP_003850117.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NY036_RS04960 (NY036_04960) | 996163..996846 | + | 684 | WP_196970670.1 | hypothetical protein | - |
NY036_RS04965 (NY036_04965) | 997058..997810 | - | 753 | WP_244659961.1 | IS30 family transposase | - |
NY036_RS04970 (NY036_04970) | 997732..998643 | - | 912 | WP_244659962.1 | helix-turn-helix domain-containing protein | - |
NY036_RS04975 (NY036_04975) | 998861..999619 | - | 759 | WP_196970671.1 | hypothetical protein | - |
NY036_RS04980 (NY036_04980) | 999728..999922 | - | 195 | WP_259516724.1 | hypothetical protein | - |
NY036_RS04985 (NY036_04985) | 999885..1000148 | - | 264 | WP_259516798.1 | LysE family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 987434..1021096 | 33662 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 9939.50 Da Isoelectric Point: 10.9201
>T256891 WP_003850119.1 NZ_CP103894:c995440-995177 [Corynebacterium diphtheriae bv. mitis]
VAWEISFSPRAVKSFKKLDTGEQRRVSKFLREVGALEDPRLRGKALTANKSGLWRWRVGDYRIIADIVDARVVVVVVDVG
HRSKVYD
VAWEISFSPRAVKSFKKLDTGEQRRVSKFLREVGALEDPRLRGKALTANKSGLWRWRVGDYRIIADIVDARVVVVVVDVG
HRSKVYD
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|