Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 377063..378093 | Replicon | chromosome |
Accession | NZ_CP103893 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 5379/19 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY037_RS01765 | Protein ID | WP_199323424.1 |
Coordinates | 377063..377482 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY037_RS01770 | Protein ID | WP_010934564.1 |
Coordinates | 377527..378093 (-) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY037_RS01750 (NY037_01750) | 373720..374574 | + | 855 | WP_010934561.1 | hypothetical protein | - |
NY037_RS01755 (NY037_01755) | 374567..375475 | - | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY037_RS01760 (NY037_01760) | 375604..376803 | - | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY037_RS01765 (NY037_01765) | 377063..377482 | - | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY037_RS01770 (NY037_01770) | 377527..378093 | - | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY037_RS01775 (NY037_01775) | 378414..378686 | - | 273 | WP_010934566.1 | hypothetical protein | - |
NY037_RS01780 (NY037_01780) | 379846..380286 | - | 441 | WP_014301588.1 | hypothetical protein | - |
NY037_RS01785 (NY037_01785) | 380374..380646 | + | 273 | WP_226813719.1 | hypothetical protein | - |
NY037_RS01790 (NY037_01790) | 380619..380987 | - | 369 | WP_244658603.1 | hypothetical protein | - |
NY037_RS01795 (NY037_01795) | 381379..381702 | - | 324 | WP_010934571.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 377063..396624 | 19561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256889 WP_199323424.1 NZ_CP103893:c377482-377063 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256889 WP_010934564.1 NZ_CP103893:c378093-377527 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|