Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 2387209..2388239 | Replicon | chromosome |
Accession | NZ_CP103892 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 8259/19 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY038_RS11140 | Protein ID | WP_199323424.1 |
Coordinates | 2387820..2388239 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY038_RS11135 | Protein ID | WP_010934564.1 |
Coordinates | 2387209..2387775 (+) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY038_RS11115 (NY038_11115) | 2383599..2383922 | + | 324 | WP_010934571.1 | hypothetical protein | - |
NY038_RS11120 (NY038_11120) | 2384212..2384799 | + | 588 | WP_241805130.1 | DUF4065 domain-containing protein | - |
NY038_RS11125 (NY038_11125) | 2385016..2385456 | + | 441 | WP_014301588.1 | hypothetical protein | - |
NY038_RS11130 (NY038_11130) | 2386616..2386888 | + | 273 | WP_010934566.1 | hypothetical protein | - |
NY038_RS11135 (NY038_11135) | 2387209..2387775 | + | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY038_RS11140 (NY038_11140) | 2387820..2388239 | + | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY038_RS11145 (NY038_11145) | 2388499..2389698 | + | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY038_RS11150 (NY038_11150) | 2389827..2390735 | + | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY038_RS11155 (NY038_11155) | 2390728..2391582 | - | 855 | WP_010934561.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2368677..2389698 | 21021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256888 WP_199323424.1 NZ_CP103892:2387820-2388239 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256888 WP_010934564.1 NZ_CP103892:2387209-2387775 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|