Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-pasA/RelE-HTH
Location 127146..127629 Replicon chromosome
Accession NZ_CP103891
Organism Corynebacterium diphtheriae bv. mitis strain 824/20

Toxin (Protein)


Gene name relE Uniprot ID A0A1X4MAI5
Locus tag NY039_RS00695 Protein ID WP_003850119.1
Coordinates 127366..127629 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag NY039_RS00690 Protein ID WP_003850117.1
Coordinates 127146..127382 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NY039_RS00660 (NY039_00660) 122658..122921 + 264 WP_259516798.1 LysE family transporter -
NY039_RS00665 (NY039_00665) 122884..123078 + 195 WP_259516724.1 hypothetical protein -
NY039_RS00670 (NY039_00670) 123187..123945 + 759 WP_196970671.1 hypothetical protein -
NY039_RS00675 (NY039_00675) 124226..125074 + 849 WP_259596491.1 helix-turn-helix domain-containing protein -
NY039_RS00680 (NY039_00680) 124996..125748 + 753 WP_244659961.1 IS30 family transposase -
NY039_RS00685 (NY039_00685) 125960..126643 - 684 WP_196970670.1 hypothetical protein -
NY039_RS00690 (NY039_00690) 127146..127382 + 237 WP_003850117.1 ribbon-helix-helix domain-containing protein Antitoxin
NY039_RS00695 (NY039_00695) 127366..127629 + 264 WP_003850119.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NY039_RS00700 (NY039_00700) 127755..128048 + 294 WP_014302727.1 RNA-binding S4 domain-containing protein -
NY039_RS00705 (NY039_00705) 128048..128872 + 825 WP_014301205.1 VOC family protein -
NY039_RS00710 (NY039_00710) 128878..129183 + 306 WP_003850125.1 MGMT family protein -
NY039_RS00715 (NY039_00715) 129193..130113 - 921 WP_021335362.1 alpha/beta hydrolase -
NY039_RS00720 (NY039_00720) 130253..130879 + 627 WP_003850128.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 92272..135830 43558


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

Predicted DNA-binding protein, ribbon-helix-helix domain

(7-43)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 9939.50 Da        Isoelectric Point: 10.9201

>T256886 WP_003850119.1 NZ_CP103891:127366-127629 [Corynebacterium diphtheriae bv. mitis]
VAWEISFSPRAVKSFKKLDTGEQRRVSKFLREVGALEDPRLRGKALTANKSGLWRWRVGDYRIIADIVDARVVVVVVDVG
HRSKVYD

Download         Length: 264 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8911.02 Da        Isoelectric Point: 4.8604

>AT256886 WP_003850117.1 NZ_CP103891:127146-127382 [Corynebacterium diphtheriae bv. mitis]
MSGSVISLRIDDEQKRRLDELSRRTGRPCSFYLREALSAHLADLEYVYRLEEEAAQVRRGELGTVPLSQLERECGLGD

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X4MAI5

Antitoxin

Source ID Structure

References