Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-pasA/RelE-HTH
Location 995172..995655 Replicon chromosome
Accession NZ_CP103890
Organism Corynebacterium diphtheriae bv. mitis strain 38009/20

Toxin (Protein)


Gene name relE Uniprot ID A0A1X4MAI5
Locus tag NY040_RS04950 Protein ID WP_003850119.1
Coordinates 995172..995435 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag NY040_RS04955 Protein ID WP_003850117.1
Coordinates 995419..995655 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NY040_RS04925 (NY040_04925) 991922..992548 - 627 WP_003850128.1 hypothetical protein -
NY040_RS04930 (NY040_04930) 992688..993608 + 921 WP_021335362.1 alpha/beta hydrolase -
NY040_RS04935 (NY040_04935) 993618..993923 - 306 WP_003850125.1 MGMT family protein -
NY040_RS04940 (NY040_04940) 993929..994753 - 825 WP_014301205.1 VOC family protein -
NY040_RS04945 (NY040_04945) 994753..995046 - 294 WP_014302727.1 RNA-binding S4 domain-containing protein -
NY040_RS04950 (NY040_04950) 995172..995435 - 264 WP_003850119.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NY040_RS04955 (NY040_04955) 995419..995655 - 237 WP_003850117.1 ribbon-helix-helix domain-containing protein Antitoxin
NY040_RS04960 (NY040_04960) 996158..996841 + 684 WP_196970670.1 hypothetical protein -
NY040_RS04965 (NY040_04965) 997053..997805 - 753 WP_244659961.1 IS30 family transposase -
NY040_RS04970 (NY040_04970) 997727..998638 - 912 WP_244659962.1 helix-turn-helix domain-containing protein -
NY040_RS04975 (NY040_04975) 998856..999614 - 759 WP_196970671.1 hypothetical protein -
NY040_RS04980 (NY040_04980) 999723..999917 - 195 WP_259516724.1 hypothetical protein -
NY040_RS04985 (NY040_04985) 999880..1000143 - 264 WP_259516798.1 LysE family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 987429..1030697 43268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

Predicted DNA-binding protein, ribbon-helix-helix domain

(7-43)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 9939.50 Da        Isoelectric Point: 10.9201

>T256885 WP_003850119.1 NZ_CP103890:c995435-995172 [Corynebacterium diphtheriae bv. mitis]
VAWEISFSPRAVKSFKKLDTGEQRRVSKFLREVGALEDPRLRGKALTANKSGLWRWRVGDYRIIADIVDARVVVVVVDVG
HRSKVYD

Download         Length: 264 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8911.02 Da        Isoelectric Point: 4.8604

>AT256885 WP_003850117.1 NZ_CP103890:c995655-995419 [Corynebacterium diphtheriae bv. mitis]
MSGSVISLRIDDEQKRRLDELSRRTGRPCSFYLREALSAHLADLEYVYRLEEEAAQVRRGELGTVPLSQLERECGLGD

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X4MAI5

Antitoxin

Source ID Structure

References