Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 2401431..2402461 | Replicon | chromosome |
Accession | NZ_CP103889 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 49390/20 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY041_RS11280 | Protein ID | WP_199323424.1 |
Coordinates | 2402042..2402461 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY041_RS11275 | Protein ID | WP_010934564.1 |
Coordinates | 2401431..2401997 (+) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY041_RS11255 (NY041_11255) | 2397821..2398144 | + | 324 | WP_010934571.1 | hypothetical protein | - |
NY041_RS11260 (NY041_11260) | 2398434..2399021 | + | 588 | WP_241805130.1 | DUF4065 domain-containing protein | - |
NY041_RS11265 (NY041_11265) | 2399238..2399678 | + | 441 | WP_014301588.1 | hypothetical protein | - |
NY041_RS11270 (NY041_11270) | 2400838..2401110 | + | 273 | WP_010934566.1 | hypothetical protein | - |
NY041_RS11275 (NY041_11275) | 2401431..2401997 | + | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY041_RS11280 (NY041_11280) | 2402042..2402461 | + | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY041_RS11285 (NY041_11285) | 2402721..2403920 | + | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY041_RS11290 (NY041_11290) | 2404049..2404957 | + | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY041_RS11295 (NY041_11295) | 2404950..2405804 | - | 855 | WP_010934561.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2382900..2403920 | 21020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256883 WP_199323424.1 NZ_CP103889:2402042-2402461 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256883 WP_010934564.1 NZ_CP103889:2401431-2401997 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|