Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/Fic-DUF4065 |
Location | 739458..740488 | Replicon | chromosome |
Accession | NZ_CP103888 | ||
Organism | Corynebacterium diphtheriae bv. gravis strain 14225/20 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NY042_RS03590 | Protein ID | WP_199323424.1 |
Coordinates | 739458..739877 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | Q6NIH9 |
Locus tag | NY042_RS03595 | Protein ID | WP_010934564.1 |
Coordinates | 739922..740488 (-) | Length | 189 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY042_RS03575 (NY042_03575) | 736115..736969 | + | 855 | WP_010934561.1 | hypothetical protein | - |
NY042_RS03580 (NY042_03580) | 736962..737870 | - | 909 | WP_010934562.1 | DUF1906 domain-containing protein | - |
NY042_RS03585 (NY042_03585) | 737999..739198 | - | 1200 | WP_010934563.1 | cation:proton antiporter | - |
NY042_RS03590 (NY042_03590) | 739458..739877 | - | 420 | WP_199323424.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NY042_RS03595 (NY042_03595) | 739922..740488 | - | 567 | WP_010934564.1 | Panacea domain-containing protein | Antitoxin |
NY042_RS03600 (NY042_03600) | 740809..741081 | - | 273 | WP_010934566.1 | hypothetical protein | - |
NY042_RS03605 (NY042_03605) | 742241..742681 | - | 441 | WP_014301588.1 | hypothetical protein | - |
NY042_RS03610 (NY042_03610) | 742769..743041 | + | 273 | WP_226813719.1 | hypothetical protein | - |
NY042_RS03615 (NY042_03615) | 743014..743382 | - | 369 | WP_244658603.1 | hypothetical protein | - |
NY042_RS03620 (NY042_03620) | 743774..744097 | - | 324 | WP_010934571.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 739458..759018 | 19560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15548.73 Da Isoelectric Point: 8.7021
>T256882 WP_199323424.1 NZ_CP103888:c739877-739458 [Corynebacterium diphtheriae bv. gravis]
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
MVKKLVYLSCTLNQKCGQRTGPHREPEPFLGFSVRDRSGLEGAIASVFQSSFDVLLYPTIYDQAAALLFKLANGHYFQDG
NKRTAFHLCLAYLRANNVHVSPPRSDDVITLLQTTVSRSGSQENGIAFVRQKLLDWTVD
Download Length: 420 bp
Antitoxin
Download Length: 189 a.a. Molecular weight: 21022.71 Da Isoelectric Point: 4.6246
>AT256882 WP_010934564.1 NZ_CP103888:c740488-739922 [Corynebacterium diphtheriae bv. gravis]
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
MISILHVAARVLELRPSCDKMKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADDDRLVTQIWSGD
SSQLIDYERSVVDTVVSFYGDLESFHLSDLSHGFAWSTVRGNLPPDASCSDVIPHSLIRREFVENAWGEAPTPNAPERLP
SMALDALEQAADDVAAENAETLRLLAFI
Download Length: 567 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|