Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 102578..103155 | Replicon | chromosome |
Accession | NZ_CP103872 | ||
Organism | Herbaspirillum huttiense strain ZXN111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NY669_RS00360 | Protein ID | WP_259433826.1 |
Coordinates | 102578..102943 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NY669_RS00365 | Protein ID | WP_259433827.1 |
Coordinates | 102937..103155 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY669_RS00330 (NY669_00330) | 97968..98153 | + | 186 | WP_259433822.1 | hypothetical protein | - |
NY669_RS00335 (NY669_00335) | 98202..98447 | + | 246 | WP_034332290.1 | ferrous iron transport protein A | - |
NY669_RS00340 (NY669_00340) | 98444..100270 | + | 1827 | WP_259433823.1 | ferrous iron transporter B | - |
NY669_RS00345 (NY669_00345) | 100267..100554 | + | 288 | WP_259433824.1 | hypothetical protein | - |
NY669_RS00350 (NY669_00350) | 100588..101793 | - | 1206 | WP_034332296.1 | threonine ammonia-lyase | - |
NY669_RS00355 (NY669_00355) | 102154..102510 | + | 357 | WP_259433825.1 | hypothetical protein | - |
NY669_RS00360 (NY669_00360) | 102578..102943 | - | 366 | WP_259433826.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NY669_RS00365 (NY669_00365) | 102937..103155 | - | 219 | WP_259433827.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NY669_RS00370 (NY669_00370) | 103298..103870 | + | 573 | WP_259433828.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
NY669_RS00375 (NY669_00375) | 103925..104791 | - | 867 | WP_259433829.1 | ABC transporter permease | - |
NY669_RS00380 (NY669_00380) | 104807..105679 | - | 873 | WP_259433830.1 | ABC transporter ATP-binding protein | - |
NY669_RS00385 (NY669_00385) | 105660..106601 | - | 942 | WP_259435340.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13987.18 Da Isoelectric Point: 5.8943
>T256875 WP_259433826.1 NZ_CP103872:c102943-102578 [Herbaspirillum huttiense]
MVKALFDTNILVDYLNGIGHAKKELARYEYRAISIITWMEIMVGANEENEEALRYWLSSFQVISLDGFIAERAVQIRQQR
RIRLPDAIVWASAMEQSLLLISRNTKDFPADEPGVRVPYKI
MVKALFDTNILVDYLNGIGHAKKELARYEYRAISIITWMEIMVGANEENEEALRYWLSSFQVISLDGFIAERAVQIRQQR
RIRLPDAIVWASAMEQSLLLISRNTKDFPADEPGVRVPYKI
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|