Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 298210..298862 | Replicon | chromosome |
Accession | NZ_CP103866 | ||
Organism | Laceyella sacchari strain FBKL4.014 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7W2AID8 |
Locus tag | NYR52_RS01630 | Protein ID | WP_022738671.1 |
Coordinates | 298512..298862 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2I7SWQ4 |
Locus tag | NYR52_RS01625 | Protein ID | WP_035952874.1 |
Coordinates | 298210..298506 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR52_RS01595 (NYR52_01595) | 293701..294156 | - | 456 | WP_259436157.1 | DUF2269 domain-containing protein | - |
NYR52_RS01600 (NYR52_01600) | 294209..294496 | - | 288 | WP_132223499.1 | antibiotic biosynthesis monooxygenase family protein | - |
NYR52_RS01605 (NYR52_01605) | 294684..295067 | + | 384 | WP_132223502.1 | holo-ACP synthase | - |
NYR52_RS01610 (NYR52_01610) | 295263..296291 | + | 1029 | WP_259436158.1 | outer membrane lipoprotein carrier protein LolA | - |
NYR52_RS01615 (NYR52_01615) | 296410..296838 | + | 429 | WP_132223508.1 | hypothetical protein | - |
NYR52_RS01620 (NYR52_01620) | 296843..298051 | + | 1209 | WP_259436159.1 | alanine racemase | - |
NYR52_RS01625 (NYR52_01625) | 298210..298506 | + | 297 | WP_035952874.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NYR52_RS01630 (NYR52_01630) | 298512..298862 | + | 351 | WP_022738671.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYR52_RS01635 (NYR52_01635) | 299065..300069 | + | 1005 | WP_132223514.1 | PP2C family protein-serine/threonine phosphatase | - |
NYR52_RS01640 (NYR52_01640) | 300092..300427 | + | 336 | WP_022738669.1 | STAS domain-containing protein | - |
NYR52_RS01645 (NYR52_01645) | 300424..300909 | + | 486 | WP_022738667.1 | anti-sigma B factor RsbW | - |
NYR52_RS01650 (NYR52_01650) | 300875..301660 | + | 786 | WP_022738666.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12912.98 Da Isoelectric Point: 5.1224
>T256871 WP_022738671.1 NZ_CP103866:298512-298862 [Laceyella sacchari]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKAYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSRVNEALMISLGMIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKAYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSRVNEALMISLGMIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W2AID8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7SWQ4 |