Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 81091..81650 Replicon plasmid pRV06-1
Accession NZ_CP103865
Organism Escherichia coli O157:H7 strain RV06

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag NUE47_RS27475 Protein ID WP_000421248.1
Coordinates 81091..81366 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag NUE47_RS27480 Protein ID WP_001178089.1
Coordinates 81366..81650 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE47_RS27440 (76444) 76444..76833 - 390 WP_001172748.1 cytochrome b562 -
NUE47_RS27445 (76877) 76877..79087 - 2211 WP_000592771.1 catalase/peroxidase KatP -
NUE47_RS27450 (79264) 79264..79449 + 186 WP_001302179.1 hypothetical protein -
NUE47_RS27455 (79449) 79449..79865 + 417 Protein_76 IS91 family transposase -
NUE47_RS27460 (79865) 79865..80431 + 567 Protein_77 IS3-like element IS600 family transposase -
NUE47_RS27465 (80475) 80475..80690 + 216 Protein_78 transposase -
NUE47_RS27470 (80790) 80790..80996 - 207 WP_001105064.1 hypothetical protein -
NUE47_RS27475 (81091) 81091..81366 - 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NUE47_RS27480 (81366) 81366..81650 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
NUE47_RS27485 (82562) 82562..83419 - 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
NUE47_RS27490 (83412) 83412..83486 - 75 WP_001370046.1 RepA leader peptide Tap -
NUE47_RS27495 (83722) 83722..83976 - 255 WP_000083831.1 replication regulatory protein RepA -
NUE47_RS27500 (84216) 84216..84554 - 339 WP_000766796.1 hypothetical protein -
NUE47_RS27505 (84592) 84592..84801 - 210 WP_001302200.1 hemolysin expression modulator Hha -
NUE47_RS27510 (84847) 84847..85308 - 462 WP_001233853.1 thermonuclease family protein -
NUE47_RS27515 (85553) 85553..85765 - 213 WP_001302189.1 ANR family transcriptional regulator -
NUE47_RS27520 (85898) 85898..86458 - 561 WP_000840472.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / toxB 1..92705 92705


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T256870 WP_000421248.1 NZ_CP103865:c81366-81091 [Escherichia coli O157:H7]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT256870 WP_001178089.1 NZ_CP103865:c81650-81366 [Escherichia coli O157:H7]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References