Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 34052..34577 | Replicon | plasmid pRV06-1 |
| Accession | NZ_CP103865 | ||
| Organism | Escherichia coli O157:H7 strain RV06 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NUE47_RS27250 | Protein ID | WP_001159868.1 |
| Coordinates | 34052..34357 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NUE47_RS27255 | Protein ID | WP_000813634.1 |
| Coordinates | 34359..34577 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE47_RS27230 (29255) | 29255..30421 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| NUE47_RS27235 (31009) | 31009..31347 | - | 339 | WP_071525396.1 | RepB family plasmid replication initiator protein | - |
| NUE47_RS27240 (31309) | 31309..32522 | + | 1214 | WP_162829202.1 | IS3-like element IS1203 family transposase | - |
| NUE47_RS27245 (33245) | 33245..34051 | - | 807 | WP_000016989.1 | site-specific integrase | - |
| NUE47_RS27250 (34052) | 34052..34357 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NUE47_RS27255 (34359) | 34359..34577 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NUE47_RS27260 (35036) | 35036..35719 | + | 684 | WP_010891291.1 | DNA-binding protein | - |
| NUE47_RS27265 (35716) | 35716..36336 | + | 621 | WP_001248529.1 | hypothetical protein | - |
| NUE47_RS27270 (36333) | 36333..36533 | + | 201 | WP_000708307.1 | hypothetical protein | - |
| NUE47_RS27275 (36941) | 36941..37918 | + | 978 | WP_000361615.1 | RepB family plasmid replication initiator protein | - |
| NUE47_RS27280 (38203) | 38203..38943 | - | 741 | WP_001066920.1 | tyrosine-type recombinase/integrase | - |
| NUE47_RS27285 (39064) | 39064..39294 | - | 231 | WP_010891288.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / toxB | 1..92705 | 92705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T256869 WP_001159868.1 NZ_CP103865:c34357-34052 [Escherichia coli O157:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|